BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0026 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.9 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 448 GKYQKYIFELNFSSTVKN 395 GKY++YI N+S N Sbjct: 194 GKYKEYIIPANYSGWYLN 211 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 448 GKYQKYIFELNFSSTVKN 395 GKY++YI N+S N Sbjct: 194 GKYKEYIIPANYSGWYLN 211 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.9 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +3 Query: 219 ERR*ISECLSTSKLDARPNDSAGDPLMLTPFLKNESIALAQELSRVSLT 365 E+R +++ L T + RP + +PL+L+ L I E +++ +T Sbjct: 24 EKRLLNDLLDTYNVLERPVGNESEPLVLSFGLTLMQIIDVDEKNQLLIT 72 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 428 YVLLVFPAFIEERSCTGFAVAARRSRGSSLFGLFTEVGPLIAS 556 ++++ P FI TGFA+ + ++ G T +G I + Sbjct: 96 FMMIKTPIFIYNSFNTGFALGNLGCQIFAVIGSLTGIGAAITN 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,930 Number of Sequences: 438 Number of extensions: 4564 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -