BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0020 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 4.1 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 9.4 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 77 LCIIKIYTEMDIIFRKINSIEHFDIICNEIINNMYTRSDEKISEIVENNVI-QTAK 241 LC+ +I+ + + F S+E + E++ +Y +D++++E N+I TAK Sbjct: 135 LCLPQIFNNILMDF----SVEQINRSIQELMIYLYNCTDQQLAEFKRANIIPDTAK 186 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 486 VLTSFRFAAPKNKLQEPIKASNNFPIRTI 400 +L FRF K+++ P+K + + I TI Sbjct: 462 LLKHFRFTLAKDRMSVPLKITPSSTILTI 490 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,628 Number of Sequences: 2352 Number of extensions: 12522 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -