BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0019 (854 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 5.4 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 5.4 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 7.1 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 7.1 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 7.1 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 9.4 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 9.4 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 9.4 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 143 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 232 + L + T F FLA+ +K D+ VDV Sbjct: 99 MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 143 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 232 + L + T F FLA+ +K D+ VDV Sbjct: 99 MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 547 TH*LSASKRKSEKAGXEISTISQKTAPYFKKIDED 651 T +S SK KSE A + + K++DE+ Sbjct: 252 TQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 547 TH*LSASKRKSEKAGXEISTISQKTAPYFKKIDED 651 T +S SK KSE A + + K++DE+ Sbjct: 252 TQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 547 TH*LSASKRKSEKAGXEISTISQKTAPYFKKIDED 651 T +S SK KSE A + + K++DE+ Sbjct: 252 TQSMSESKNKSESAWKNLREDYNRLCRLCKRVDEE 286 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 489 LRTIERNFNYFLNALKNDLDTLA 557 L+ IE NFN F+ ALK+++ A Sbjct: 274 LKHIE-NFNDFVTALKDNVPVFA 295 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 489 LRTIERNFNYFLNALKNDLDTLA 557 L+ IE NFN F+ ALK+++ A Sbjct: 274 LKHIE-NFNDFVTALKDNVPVFA 295 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 489 LRTIERNFNYFLNALKNDLDTLA 557 L+ IE NFN F+ ALK+++ A Sbjct: 594 LKHIE-NFNDFVTALKDNVPVFA 615 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,260 Number of Sequences: 336 Number of extensions: 3648 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -