BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0017 (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 37 0.017 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 33 0.21 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 31 1.1 SB_56258| Best HMM Match : MAPEG (HMM E-Value=0.86) 30 2.0 SB_41731| Best HMM Match : bZIP_1 (HMM E-Value=0.014) 30 2.0 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 29 2.6 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 29 2.6 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 28 6.0 SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24737| Best HMM Match : KID (HMM E-Value=0.096) 28 6.0 SB_26424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_20518| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=7.4) 28 6.0 SB_10324| Best HMM Match : IFP_35_N (HMM E-Value=0.1) 28 7.9 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 7.9 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +2 Query: 317 IRSEQTNNFIVATKEALDAKMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQ 481 I EQ +E + KME +EKR++Y+ L++RL + VE+ R T+E+ Sbjct: 189 IAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTMEE 243 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 33.1 bits (72), Expect = 0.21 Identities = 22/77 (28%), Positives = 41/77 (53%) Frame = +2 Query: 389 EEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIKIR*PQLPTSGDENLKKMIE 568 ++K + I E ++R H + +E+ R E++ EV + R L E+L+K E Sbjct: 153 QQKEKERIEEEKNRAAAHQQELERKRKEREEKQQEVDE----REDHLQKKRSESLRK--E 206 Query: 569 RLREHEXQVSQGPRRQP 619 R++E E ++QG ++P Sbjct: 207 RMKEAEALIAQGKEQKP 223 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +2 Query: 350 ATKEALDAKMETXEEKREAYINELRSRLKDHLEG-VEKTRLTLEQQTAEV 496 A ++AL+A +E R+ + ELR ++ + E +E+ R+ E+Q AE+ Sbjct: 52 AIRDALNAAEAKAQEDRKQALEELRKKMNEEREQCLEQARIRAEEQMAEI 101 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/105 (24%), Positives = 51/105 (48%) Frame = +2 Query: 350 ATKEALDAKMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIKIR*PQL 529 + KE +M T +EK + + ++L+D L K++ Q+ +E Y+A+K ++ Sbjct: 423 SNKEKEYKRMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALK---NEM 479 Query: 530 PTSGDENLKKMIERLREHEXQVSQGPRRQPGEVPAARERPSQEKL 664 G E LK+ E ++ E + + + EV R+ S++ L Sbjct: 480 QQQGKEWLKQDKESHKQIEEREKE-CKSLRDEVRKLRDNLSKQDL 523 >SB_56258| Best HMM Match : MAPEG (HMM E-Value=0.86) Length = 193 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = -3 Query: 667 LQLLLGWPLSSCWNFSWLPARTLRNLXLMFAQTLDHLLEVLVAACRQLWSSYLDGLVHFR 488 +Q+ LG L WN +W R +R+ +F + H + A + YL L HF+ Sbjct: 126 MQITLGVSLCLLWNITWY-IRRVRDHIHVFPRRFSHSCPICTHAHANTHTIYL-FLTHFQ 183 Query: 487 GL 482 G+ Sbjct: 184 GI 185 >SB_41731| Best HMM Match : bZIP_1 (HMM E-Value=0.014) Length = 289 Score = 29.9 bits (64), Expect = 2.0 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 5/103 (4%) Frame = +2 Query: 356 KEALDAKMETXEEKREAYINELR-SRLKDHLEGVEKTRLTLEQQTAEVYKAIKIR*PQLP 532 KE LD K T + K + E+ SR+++ LE +E + + + ++ + Sbjct: 66 KEMLDLKPITAKIKAKLQEAEVEISRVQNSLEYLENQSRRNNIRVSGIPESPGESWDDVE 125 Query: 533 TSGDENLKKM----IERLREHEXQVSQGPRRQPGEVPAARERP 649 EN+K+ IE R H + GPRR+ G A+R++P Sbjct: 126 AKVKENIKQALGLEIEIERAHRVERRPGPRRRDGGRDASRDQP 168 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/77 (25%), Positives = 47/77 (61%), Gaps = 3/77 (3%) Frame = +2 Query: 359 EALDAKMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKA---IKIR*PQL 529 EA+ +M E+K + ++ E ++ L++ L ++KT+ L Q+ E+++A I + ++ Sbjct: 2863 EAVKKEMVATEKKVKLFL-EKQNLLEEKLLLLQKTKEELRQKETELHEAREEITVLMNRI 2921 Query: 530 PTSGDENLKKMIERLRE 580 +S D+ +KK+++ + E Sbjct: 2922 ESSKDKQIKKVMKAVCE 2938 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/80 (22%), Positives = 35/80 (43%) Frame = +1 Query: 319 PQRADE*LHRRHQGGSRRQDGDPXGKTRGLHQRAALPSQGSS*GR*EDQVDPGTADRGSV 498 PQ ++ R Q + + P K ++A+ ++ S + +D+ D A R + Sbjct: 556 PQDQEKQATRPRQASRKTKTSKPQDKQAARPKQASRKTKTSKTSKPQDKQDARPASRRTK 615 Query: 499 QGHQDKMTTAADKRRREPQE 558 QDK + + R+PQ+ Sbjct: 616 PQDQDKQDASRKTKTRKPQD 635 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 29.5 bits (63), Expect = 2.6 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 4/121 (3%) Frame = +2 Query: 311 SRIRSEQTNNFIVATK-EALDAKMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 487 SR+ SE + I K + +A +E ++K + INE R +L++ ++ ++ + Sbjct: 1455 SRLNSELEDALIDLEKAQTNNANLEKKQKKIDIQINEWRVKLEEVQADLDNSQKEARNYS 1514 Query: 488 AEVYK---AIKIR*PQLPTSGDENLKKMIERLREHEXQVSQGPRRQPGEVPAARERPSQE 658 E+YK A + Q+ EN K + + + Q+ +G + E+ R+R E Sbjct: 1515 TEMYKIKAAFDEQSEQVEALKREN-KSLASEVNDLADQLGEG-GKSVVELEKLRKRLEME 1572 Query: 659 K 661 K Sbjct: 1573 K 1573 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 69 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLIAAEE 242 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 285 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 344 Query: 243 RRRS 254 ++RS Sbjct: 345 KQRS 348 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 28.7 bits (61), Expect = 4.5 Identities = 22/98 (22%), Positives = 40/98 (40%), Gaps = 1/98 (1%) Frame = +1 Query: 286 EDGQDRGGVPHPQRADE*LHRRHQGGSRRQDGDPXGKTRGLHQRAALPSQGSS*GR*EDQ 465 +D D+GG ++ + R+Q RQD + + R Q P + S G D+ Sbjct: 994 KDRSDKGGDRLQEKPSQRKDERYQSDKGRQDRERPERDRRDRQEKERPYKQSGRGERNDR 1053 Query: 466 VDPGTADRGSV-QGHQDKMTTAADKRRREPQEDDRASA 576 DR + +D+ R+R+P + + +A Sbjct: 1054 RGERYQDRREQREREEDREPRDGKGRQRQPSDSRKPNA 1091 >SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 69 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLIAAEE 242 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 149 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 208 Query: 243 RRRS 254 ++RS Sbjct: 209 KQRS 212 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 28.3 bits (60), Expect = 6.0 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 8/112 (7%) Frame = +2 Query: 356 KEALDAKMETXEEKREAYINELRSRLKDH--LEGV-EKTRLTLEQQTAEVYKAIKIR*PQ 526 K + ++ + K EL+S +K L+GV E+T+L + E+ K K Q Sbjct: 2110 KNDMRIALQDSQNKLGGLEEELQSEMKQQAQLKGVLEQTKLRNDNLKEEILKLQKKLAEQ 2169 Query: 527 LPTSGDE-----NLKKMIERLREHEXQVSQGPRRQPGEVPAARERPSQEKLQ 667 D+ LK +IERLRE + E+ + R+ + L+ Sbjct: 2170 QKYHEDQIRDFPELKAVIERLREENENLENDNEMMKNELNSLRDEHERVSLE 2221 >SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 308 PPRSWPSSEQWRPSY 264 PP ++PSS+QW P+Y Sbjct: 508 PPGAYPSSDQWIPAY 522 >SB_24737| Best HMM Match : KID (HMM E-Value=0.096) Length = 636 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/94 (24%), Positives = 46/94 (48%) Frame = +2 Query: 374 KMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIKIR*PQLPTSGDENL 553 ++++ E RE I++L LKD + + TLEQ A++ + ++ + GD N Sbjct: 142 ELQSVIEDREKSIDKLEKELKDQEAKHNRQKNTLEQTVAKMKEVMERK------GGDAN- 194 Query: 554 KKMIERLREHEXQVSQGPRRQPGEVPAARERPSQ 655 K+ R+ E E ++ + + V A+ +R + Sbjct: 195 -KVNARVAELEKELKEKTKSAEKLVKASEKREKE 227 >SB_26424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 482 QTAEVYKAIKIR*PQLPTSGDENLKKMIERLREH--EXQVSQGPRRQP 619 Q A Y + L + +ENLKK ++ R H + + SQ P+R P Sbjct: 287 QMASEYAERDFKSSALSSGNNENLKKQEQQFRAHCKDPKRSQDPKRSP 334 >SB_20518| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=7.4) Length = 494 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +2 Query: 443 LEGVEKTRLTLEQQTAEVYKA----IKIR*PQLPTSGDENLKKMIERLREHEXQVSQGPR 610 L G + + L++++ +++ + +R P + + +E K +E + Q PR Sbjct: 53 LAGDPEDEILLKKKSLQIHAGNWATLLLRPPNVDQNLEEECKNELEEMDVPRPQPIHSPR 112 Query: 611 RQPGEVPAARERP 649 R P +V + RP Sbjct: 113 RNPADVVPKKRRP 125 >SB_10324| Best HMM Match : IFP_35_N (HMM E-Value=0.1) Length = 798 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 135 VILAEPVGVPVPRRADSPEKTPSVEEIQEKLIAAEERRRSWK 260 VI PV P PR KT +E L EER++ WK Sbjct: 662 VIPEAPVFDPKPRTPTVSRKTSMKLTAEEHLQLEEERKKMWK 703 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.9 bits (59), Expect = 7.9 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 3/105 (2%) Frame = +2 Query: 362 ALDAKMETXEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIKIR*PQLPTSG 541 A + K E+RE E R++ E E+ R EQ+ V + + P + Sbjct: 499 AEEEKRRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALECAIKPLNL 558 Query: 542 DE---NLKKMIERLREHEXQVSQGPRRQPGEVPAARERPSQEKLQ 667 E +K+ E RE E ++ ++ E+ RE+ +EK Q Sbjct: 559 LEARIKAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKAQ 603 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 329 QTNNFIVATKEALDAKMETXEEKREAYINELRSRLKDHLEGVEK--TRLTLEQQTAEVYK 502 QT I+ E ME + + E EL +L+ K T+L L Q+TAE YK Sbjct: 401 QTQILILQVHEDYRKLMEQKQAEEERCRKELEEKLQTLERDSHKYRTKLELAQKTAETYK 460 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,459,737 Number of Sequences: 59808 Number of extensions: 320175 Number of successful extensions: 1270 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -