BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0016 (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) 33 0.25 SB_48462| Best HMM Match : zf-C2H2 (HMM E-Value=1.1e-18) 30 1.8 SB_35180| Best HMM Match : DUF795 (HMM E-Value=2.1) 28 7.2 SB_32654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) Length = 334 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/57 (24%), Positives = 33/57 (57%) Frame = -1 Query: 517 HQTREQSKNIPRWKRYVQKEC*LAFNLIFFSSLSYPISRQHQMVVVNPHDRWTSIFV 347 H+ QS+++P+W+RY +NLI++ +L++P Q +++ + ++ + V Sbjct: 9 HRQALQSEDLPKWERY------YGYNLIYYYNLTHPTYSQLLLLITRSSENFSRLHV 59 >SB_48462| Best HMM Match : zf-C2H2 (HMM E-Value=1.1e-18) Length = 536 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -2 Query: 594 AVNEIQTVILYVESHHITTQNSLQNFIRPGNSLKISHGGNGMC 466 A ++QT + ++ S+ IT + + I+PGN L++S G C Sbjct: 438 ARKQVQTRMSFMSSNEITPRITAGVGIQPGNKLEVSQTGREKC 480 >SB_35180| Best HMM Match : DUF795 (HMM E-Value=2.1) Length = 388 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 523 KLHQTREQSKNIPRWKRYVQKE 458 K +T+ N P+WK Y+Q+E Sbjct: 200 KYEKTQALDSNFPKWKEYIQQE 221 >SB_32654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -2 Query: 369 IGGLPFLSFFCLFSRWRAWTVFSANSSFILIYAFQWSARKWHGLASNETTARMSRYSI 196 +GG+ + + SR+ W + ++ L Y Q ARK H SN+ T ++ YS+ Sbjct: 18 VGGIVITGIY-IVSRYARWRLDEWRANQELEYIAQ--ARKQHHFESNQRTCSVTLYSL 72 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,539,810 Number of Sequences: 59808 Number of extensions: 597127 Number of successful extensions: 1489 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -