BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0016 (763 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80759-1|AAB91450.1| 182|Homo sapiens CAGH4 alternate open read... 35 0.28 AY312370-1|AAQ85138.1| 74|Homo sapiens AAA1 variant VI protein. 31 5.9 >U80759-1|AAB91450.1| 182|Homo sapiens CAGH4 alternate open reading frame protein. Length = 182 Score = 35.1 bits (77), Expect = 0.28 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +3 Query: 591 LLPK--KLGLPCR*KKSSGRTGRXAPSA*DRLPIGVAIPRDFVPAWPKNAXAPXSP 752 LLP +L LP R +S T R PS LP+ + IP F P P+ P +P Sbjct: 19 LLPSLPRLSLPFRLPWASTATARCPPSPLGSLPLMLCIPTGFTPTQPRAPRPPWTP 74 >AY312370-1|AAQ85138.1| 74|Homo sapiens AAA1 variant VI protein. Length = 74 Score = 30.7 bits (66), Expect = 5.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +2 Query: 254 LADHWKAYIKIN--EEFAEKTVHALHLLNKQKKD 349 L D+WKAY++ N +F+ +HA L ++K+D Sbjct: 13 LGDYWKAYVRRNAGRQFSHCNLHAHQFLVRRKQD 46 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,481,100 Number of Sequences: 237096 Number of extensions: 2996476 Number of successful extensions: 7806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7801 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -