BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0016 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 3.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.4 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 21 9.4 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 90 SSRWGLRGGCPAILPSYPGRESQPAQLQ 7 SSR ++ GCP L ++P ++Q LQ Sbjct: 121 SSRLTIKAGCPMNLENFP-MDTQRCPLQ 147 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 583 FIDCCQRNLGCRVDRKNLLVELG 651 F C QRNL K +VELG Sbjct: 1005 FFGCRQRNLDLYRQEKEEMVELG 1027 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 66 HLEDPNEKIPESDPNDKTPTAGLRSEKIVPIRAEPKLFDSY 188 H D ++ +D N + T + + + PI++EP D+Y Sbjct: 226 HESDNSDYSHTTDENRHSSTLDIDHKMLTPIKSEP--IDAY 264 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +1 Query: 79 PTRRSLNRILMTRPQPLACVRRK*SPFARNLNFSIATTMDAVT 207 PT+R++++I +P+P + + LN ++ T + A T Sbjct: 27 PTQRTMSKIQWRKPKPAMVEEKTQLRYLEELN-ALRTELGAST 68 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 553 GFHIEDYCLNFIDCCQRNLGC 615 G+ + +FID Q+NL C Sbjct: 125 GYFLNSESKDFIDFIQKNLQC 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,025 Number of Sequences: 438 Number of extensions: 5756 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -