BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0015 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 5.5 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 21 5.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 9.6 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 5.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 209 MHFGLRDEASVSRKTPHNQFINEIRDIHQV 298 + FG R E K P N +N+I DI V Sbjct: 433 LSFG-RAEPVFDGKVPSNGSLNQISDIDDV 461 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.4 bits (43), Expect = 5.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 209 MHFGLRDEASVSRKTPHNQFINEIRDIHQV 298 + FG R E K P N +N+I DI V Sbjct: 258 LSFG-RAEPVFDGKVPSNGSLNQISDIDDV 286 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 20.6 bits (41), Expect = 9.6 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = +1 Query: 34 WVHHTPAWNWLV 69 W+ P W W V Sbjct: 173 WIEFHPQWKWQV 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,077 Number of Sequences: 336 Number of extensions: 3280 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -