BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0015 (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 5.2 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 6.9 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 23 6.9 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 23 9.1 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 129 LLHLQPSVQKTFNIMRSVMQCPSVLGQCILDC 224 LL Q S+Q TFN CP C + C Sbjct: 137 LLAPQTSMQYTFNFSSPERVCPPCHPSCEVGC 168 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 60 IPCGSMVHPFRTLPF 16 IP G HPF LPF Sbjct: 448 IPSGKEAHPFIFLPF 462 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 23.0 bits (47), Expect = 6.9 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 187 CMTDLI-ILKVFCTDGWRCSSSTYPDLKPHSAAQP 86 C T L+ +L V G CSS P PH P Sbjct: 7 CATLLLAVLSVVSVGGQYCSSDLCPRGGPHVGCNP 41 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 269 INEIRDIHQVLKERTATAYKTFNSIPGY 352 ++ +RD+ Q L+E AY++ N + + Sbjct: 78 LSAVRDLLQYLEEAGVPAYESLNVVADF 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,147 Number of Sequences: 2352 Number of extensions: 15443 Number of successful extensions: 31 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -