BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0012 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) 28 8.6 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 221 PAPPPSYFGNNHHRLPVSLLPKHLRVLQ**HH 316 P+PP +Y+ ++H + + LLP HH Sbjct: 373 PSPPSTYYHHHHQHITIKLLPSSPSTYHHYHH 404 >SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) Length = 556 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 305 TVVRGGASGATKPAGGGDYCQSTKEAELDSVPIVHGGGNPILF 177 T+ + G KPAGGG T +LD+V +V G GN F Sbjct: 275 TIPTSSSGGPDKPAGGG---PDTCTTDLDTV-VVAGDGNTYAF 313 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,216,838 Number of Sequences: 59808 Number of extensions: 495567 Number of successful extensions: 1037 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -