BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0008 (852 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M... 27 4.5 SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc... 26 7.8 >SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||Manual Length = 535 Score = 26.6 bits (56), Expect = 4.5 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 476 DQEGQEASLRCFYIRDEKQIDVETGWANATPNTN 577 D+E + + +C Y+ + ++ V GW N T T+ Sbjct: 382 DKESSDPTEKCLYLIEHQRYWVGVGWLNRTLPTD 415 >SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 596 RKGGTGGCRYGLFDFGIHAPVPGARRKASK 685 R TG +Y + + IHAP+PG K K Sbjct: 43 RSDVTGRNKYVVDELQIHAPIPGMEVKNGK 72 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,264,792 Number of Sequences: 5004 Number of extensions: 64062 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -