BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0008 (852 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 2.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 8.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 2.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 758 PTILPSWTXGGVWAPTTXRKELSVSC*PSDVPLAL 654 PT+LP W AP + S P+D PL L Sbjct: 481 PTLLPQWCLPPREAPLVGVQPHQDSATPADQPLDL 515 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 8.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 790 FXEPSEPSLEYQPSFLLGPLAVSGHXRHXGKS 695 F +P +P+LE P L P V +H GKS Sbjct: 386 FWQP-KPTLEDAPQNSLLPNFVGYKGKHIGKS 416 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,903 Number of Sequences: 438 Number of extensions: 4554 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -