BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0004 (841 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.1 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 8.1 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 84 RRYREV*FEPAEAHRDSGEEPASGQRRYXSGEGKEQIP 197 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 411 CFCTMATLPGQWRRTATPXFIQIXTISHAL 500 C C+M LPG +T+T + +I + + + Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIMDLDNVM 713 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,560 Number of Sequences: 438 Number of extensions: 3968 Number of successful extensions: 26 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -