BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0003 (854 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 31 0.034 Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease prot... 23 9.0 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 31.5 bits (68), Expect = 0.034 Identities = 18/70 (25%), Positives = 31/70 (44%) Frame = +1 Query: 55 NLVKSDYGLSKENFNYFLNALKNDLDTLAERIKEKSEKAGQEISTISQKTAPYFKKIDED 234 ++ K Y + + L ++K L+ K+KS K +K A Y K++DE Sbjct: 969 DVFKLHYKVQNNKYVLKLKSMKGPLNNSLTEQKQKSYKQIDASGEAVEKKAQYKKEVDEK 1028 Query: 235 FRREWSNFTR 264 F E N ++ Sbjct: 1029 FAEEVDNISQ 1038 >Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease protein. Length = 268 Score = 23.4 bits (48), Expect = 9.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 767 WNFSGNYPEPFHF 729 WN++ + +PFHF Sbjct: 46 WNYNNDEQDPFHF 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,533 Number of Sequences: 2352 Number of extensions: 14454 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -