BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0001 (818 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.4 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 22 5.9 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 5.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 353 LRVAPEEHPVLLTEAPLNPKANREKM 430 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 514 YDGRVQREHGLDGDVHGG 461 Y RV ++G+ GD +GG Sbjct: 60 YKQRVYDKNGMTGDAYGG 77 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 5.9 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 272 GSGYLFALCLVTYVRVLLSHTDHHALMAGPSDDRGEYGARSIISC 138 GS Y+ RVLL+ TD + S D EYG +C Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 232,722 Number of Sequences: 438 Number of extensions: 5408 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -