BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1499 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0645 + 4890647-4890682,4891684-4891929,4892021-4892317,489... 50 2e-06 01_06_0648 - 30844289-30844341,30844536-30844648,30845435-308454... 47 1e-05 05_06_0132 + 25893241-25893435,25894266-25894487,25894567-258948... 44 1e-04 01_07_0301 + 42607239-42607277,42607374-42607577,42607669-426079... 32 0.47 03_02_0138 + 5837813-5838490,5839000-5839164,5839289-5839426,583... 29 3.3 12_02_0312 + 17395716-17398112 29 4.3 11_06_0545 + 24839536-24843421,24843871-24844310 29 4.3 04_03_0910 + 20751014-20753437 29 4.3 05_04_0226 + 19215091-19215172,19215281-19215394,19215508-192155... 28 5.7 08_01_0705 + 6231220-6231390,6231900-6231954,6232043-6232194,623... 28 7.6 04_04_1122 + 31052497-31052629,31053133-31053191,31053285-310535... 28 7.6 >01_01_0645 + 4890647-4890682,4891684-4891929,4892021-4892317, 4892407-4892574,4892674-4892841,4892924-4893004, 4893105-4893171,4893657-4893751,4894027-4894099, 4894177-4894247,4894325-4894374,4895263-4895375, 4895461-4895513 Length = 505 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 3/98 (3%) Frame = +3 Query: 234 IGIVACTRSAAGLTTKNISSFLIQRKLSQIGAYVSASGDREFIYYTLEATQDKLNDALEI 413 +G + A TT N S + R++ +G V AS +RE + Y+ A + + + +E+ Sbjct: 116 LGATQLLKKMAYTTTTNRSHLRVVREIEAVGGNVKASANREMMSYSYAALKTYMPEMVEV 175 Query: 414 LNNLVSNQEFRPWELNDNAPRLKYDII---SLPPQFVL 518 L + V N F WE+ + +LK ++ S P F+L Sbjct: 176 LIDCVRNPAFLDWEVKEQIMKLKAELAEASSNPETFLL 213 >01_06_0648 - 30844289-30844341,30844536-30844648,30845435-30845484, 30845572-30845642,30845725-30845797,30846744-30846841, 30846936-30847002,30847150-30847230,30847312-30847479, 30847563-30847730,30847813-30848109,30848205-30848426, 30849287-30849325 Length = 499 Score = 47.2 bits (107), Expect = 1e-05 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 2/84 (2%) Frame = +3 Query: 273 TTKNISSFLIQRKLSQIGAYVSASGDREFIYYTLEATQDKLNDALEILNNLVSNQEFRPW 452 +T N S + R++ IG VSAS RE + YT +A + + + +E+L + V N F W Sbjct: 122 STTNRSHLRLVREVEAIGGNVSASASREQMCYTYDAFKAYVPEMVEVLIDSVRNPAFFNW 181 Query: 453 ELNDNAPRLKYDI--ISLPPQFVL 518 E+ + ++K +I +S PQ +L Sbjct: 182 EIKEQLEKIKAEIAEVSDNPQGLL 205 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 127 SVLPNKTFVAALDNGSPVTRVTIAFKAGSRYEPQAELGLSHVLDQL 264 + LPN +A+ + SP V + GS YE A G SH+L+++ Sbjct: 73 TTLPNGIKIASETSVSPAASVGLYIDCGSIYETPASSGASHLLERM 118 >05_06_0132 + 25893241-25893435,25894266-25894487,25894567-25894863, 25894944-25895111,25895201-25895368,25895456-25895536, 25895704-25895770,25895874-25895971,25896587-25896659, 25896753-25896823,25896919-25896968,25897698-25897810, 25898182-25898300,25898629-25898721,25899025-25899051, 25899422-25899823,25900467-25900513,25900612-25900651, 25900733-25900795,25900881-25901018,25901873-25902031, 25902111-25902164,25902324-25902392,25902514-25902643, 25902909-25902949,25903133-25903178,25903200-25903357, 25903560-25903605,25903702-25903853,25904022-25904243 Length = 1202 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/73 (31%), Positives = 39/73 (53%) Frame = +3 Query: 273 TTKNISSFLIQRKLSQIGAYVSASGDREFIYYTLEATQDKLNDALEILNNLVSNQEFRPW 452 +T N S + R++ IG V AS RE + YT +A + + +E+L + V N F W Sbjct: 174 STTNRSHLRLVREVEAIGGNVFASASREQMSYTYDALKCYAPEMVEVLIDSVRNPAFLEW 233 Query: 453 ELNDNAPRLKYDI 491 E+ + ++K +I Sbjct: 234 EVKEQLQKIKSEI 246 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 127 SVLPNKTFVAALDNGSPVTRVTIAFKAGSRYEPQAELGLSHVLDQL 264 + LPN +A+ + P V + GS YE + G SH+L+++ Sbjct: 125 TTLPNGIKIASETSPIPAVSVGLYIDCGSVYETSSSSGTSHLLERM 170 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 518 VDLLHKAAYRRGLGXXLFISPKRINDISSESLQLFASQNIT 640 ++ LH A Y L L S +N + +L+ F S+N T Sbjct: 258 MEALHSAGYSGALAKPLMASESAVNRLDVATLEEFVSENYT 298 >01_07_0301 + 42607239-42607277,42607374-42607577,42607669-42607965, 42608055-42608222,42608393-42608560,42608653-42608733, 42608844-42608910,42609326-42609423,42609665-42609737, 42609826-42609896,42610013-42610062,42610145-42610257, 42610341-42610384 Length = 490 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 127 SVLPNKTFVAALDNGSPVTRVTIAFKAGSRYEPQAELGLSHVLDQL 264 + LPN VA+ D P V + +GS YE G+SH+L++L Sbjct: 67 TTLPNGVRVASEDLPGPSACVGVFVDSGSVYETAETAGVSHLLERL 112 >03_02_0138 + 5837813-5838490,5839000-5839164,5839289-5839426, 5839496-5839647,5839754-5839862,5840551-5840649, 5840739-5840804,5840891-5840998,5841820-5841906 Length = 533 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 127 SVLPNKTFVAALDN-GSPVTRVTIAFKAGSRYEPQAELGLSHVLDQLL 267 + LPN VA + S V + AGSRYE + G++H ++ +L Sbjct: 102 TTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHML 149 >12_02_0312 + 17395716-17398112 Length = 798 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/61 (26%), Positives = 34/61 (55%) Frame = +3 Query: 255 RSAAGLTTKNISSFLIQRKLSQIGAYVSASGDREFIYYTLEATQDKLNDALEILNNLVSN 434 +S +G + K ++ +Q+KL ++ SGD+ ++ + + D +ND E++N L S Sbjct: 240 QSDSGESNKQLTLEALQKKLHEL------SGDKRYLLVLDDISHDNINDWEELMNLLPSG 293 Query: 435 Q 437 + Sbjct: 294 R 294 >11_06_0545 + 24839536-24843421,24843871-24844310 Length = 1441 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 345 GDREFIYYTLEATQDKLNDALEILNNLVSNQEFRPWE 455 GD +FI +E+ Q L DA + NN S+Q+ W+ Sbjct: 29 GDVQFIKDEMESMQGFLLDAADAANNNSSSQQVLAWQ 65 >04_03_0910 + 20751014-20753437 Length = 807 Score = 28.7 bits (61), Expect = 4.3 Identities = 25/82 (30%), Positives = 34/82 (41%) Frame = +1 Query: 133 LPNKTFVAALDNGSPVTRVTIAFKAGSRYEPQAELGLSHVLDQLLD*QPRILVVSLFNAN 312 +PNKT V + GSPVT T + S P L + D + + + S Sbjct: 75 VPNKTHVWIANRGSPVTDATSSHLTIS---PDGNLAIVSRADSSIVWSSQANITSNNTVA 131 Query: 313 SLRLEHMLVLLETENSSITLWK 378 L LVL + NSS LW+ Sbjct: 132 VLLDTGNLVLQSSSNSSHILWE 153 >05_04_0226 + 19215091-19215172,19215281-19215394,19215508-19215590, 19215682-19215820,19215862-19216191,19216414-19216693, 19216795-19216956,19217134-19217349,19217458-19217495, 19217597-19217760,19217833-19217946,19218042-19218083, 19218180-19218983 Length = 855 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 28 ASKTLVAPFIRHVTIRGYAQAAPAVKKDVRIQSSVLPNKTFVAALDN 168 A + + P IRH+ ++ +++ AV R Q S+ P+K V+ L + Sbjct: 673 ARRVSLTPVIRHIPLQPKRRSSLAVLPTQREQLSIFPDKRSVSRLSH 719 >08_01_0705 + 6231220-6231390,6231900-6231954,6232043-6232194, 6232252-6232335,6232614-6232797,6232885-6232988, 6233109-6233183,6233366-6233405,6233495-6233577, 6233687-6233764,6233868-6234011,6234093-6234160, 6234831-6234945,6235045-6235201,6235311-6235408 Length = 535 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 401 IIQFVLCCFQ-SVIDEFSVSRSTNICSNL 318 +I +VL CFQ SVI F V S++ CS + Sbjct: 159 VISYVLVCFQSSVILRFMVFFSSDFCSGI 187 >04_04_1122 + 31052497-31052629,31053133-31053191,31053285-31053579, 31054099-31054279,31054739-31054956,31055522-31055739, 31055842-31055958,31056106-31056128,31056223-31056438, 31056536-31056677,31056822-31057067,31057659-31057856, 31058331-31058379,31060835-31060911,31061266-31061551, 31061661-31061841,31062149-31062344,31062630-31062738, 31062861-31062961,31063155-31063267,31063347-31063442, 31063531-31063746,31063857-31063995,31064087-31064332, 31064605-31064940 Length = 1396 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +3 Query: 294 FLIQRKLSQIGAYVSASGDREFIYYTLEATQDKLNDALEILNNLVSNQEFRPWELNDNA 470 F I ++Q+GA VSA R+ + +E D L + + +SN P E +NA Sbjct: 506 FAIFNSVNQLGAKVSAVQGRDVTKHLIEIWLDLLRSMMTEVEWRISNYVPTPEEYMENA 564 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,611,914 Number of Sequences: 37544 Number of extensions: 351737 Number of successful extensions: 695 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -