BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1471 (697 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000E0E427 Cluster: hypothetical protein OM2255_0183... 33 8.8 UniRef50_Q6ZRL6 Cluster: CDNA FLJ46261 fis, clone TESTI4025062; ... 33 8.8 >UniRef50_UPI0000E0E427 Cluster: hypothetical protein OM2255_01837; n=1; alpha proteobacterium HTCC2255|Rep: hypothetical protein OM2255_01837 - alpha proteobacterium HTCC2255 Length = 154 Score = 32.7 bits (71), Expect = 8.8 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 370 YLMDSLHFDLKKNLEMLQWVKGIFLCYTHIFTQDIRLMT 486 + +DS +FD K LE +WV + + YTH FT + L T Sbjct: 78 FQLDSPYFDAKSTLERPRWV-AVDMVYTHKFTTLVPLAT 115 >UniRef50_Q6ZRL6 Cluster: CDNA FLJ46261 fis, clone TESTI4025062; n=2; Homo sapiens|Rep: CDNA FLJ46261 fis, clone TESTI4025062 - Homo sapiens (Human) Length = 280 Score = 32.7 bits (71), Expect = 8.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 68 LHTTQPQKLVTQSAATTFNIASCKNPGSTQKNRSW 172 +H T QS+ T+F SC++ G++ +RSW Sbjct: 8 MHLTSSTSCSCQSSGTSFTSCSCRSSGTSSTSRSW 42 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,372,720 Number of Sequences: 1657284 Number of extensions: 10413456 Number of successful extensions: 21455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21452 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -