BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1471 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 104 SAATTFNIASCKNPGSTQKNRSWQH*PCILWFDVHE 211 S A +N+ + K PG TQ NR H P W + E Sbjct: 7 SLAVVYNVVTGKTPGVTQLNRLAAHPPFASWRNSEE 42 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 119 FNIASCKNPGSTQKNRSWQH*PCILWFDVHE 211 +N+ + KNPG TQ NR H P W + E Sbjct: 12 YNVVTGKNPGVTQLNRLAAHPPFASWRNSEE 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,243,281 Number of Sequences: 59808 Number of extensions: 325467 Number of successful extensions: 789 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -