BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1471 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128140-1|BAC87294.1| 280|Homo sapiens protein ( Homo sapiens ... 33 1.3 AK125824-1|BAC86307.1| 280|Homo sapiens protein ( Homo sapiens ... 33 1.3 >AK128140-1|BAC87294.1| 280|Homo sapiens protein ( Homo sapiens cDNA FLJ46261 fis, clone TESTI4025062. ). Length = 280 Score = 32.7 bits (71), Expect = 1.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 68 LHTTQPQKLVTQSAATTFNIASCKNPGSTQKNRSW 172 +H T QS+ T+F SC++ G++ +RSW Sbjct: 8 MHLTSSTSCSCQSSGTSFTSCSCRSSGTSSTSRSW 42 >AK125824-1|BAC86307.1| 280|Homo sapiens protein ( Homo sapiens cDNA FLJ43836 fis, clone TESTI4005857. ). Length = 280 Score = 32.7 bits (71), Expect = 1.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 68 LHTTQPQKLVTQSAATTFNIASCKNPGSTQKNRSW 172 +H T QS+ T+F SC++ G++ +RSW Sbjct: 8 MHLTSSTSCSCQSSGTSFTSCSCRSSGTSSTSRSW 42 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,678,752 Number of Sequences: 237096 Number of extensions: 1654531 Number of successful extensions: 2280 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2280 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -