BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1457 (742 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41991-1|AAA83341.2| 1400|Caenorhabditis elegans Rna polymerase,... 31 0.86 AL032665-1|CAA21771.1| 294|Caenorhabditis elegans Hypothetical ... 28 8.0 >U41991-1|AAA83341.2| 1400|Caenorhabditis elegans Rna polymerase, class iii (c) protein1 protein. Length = 1400 Score = 31.1 bits (67), Expect = 0.86 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 136 YNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKSGTP 264 YN+ GD + + YE++ + S + NV NNLI +SG P Sbjct: 492 YNADFDGD-EMNLHLPQTYEAKAEASELMNVKNNLITPRSGEP 533 >AL032665-1|CAA21771.1| 294|Caenorhabditis elegans Hypothetical protein Y76A2A.1 protein. Length = 294 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = -3 Query: 152 VRMLLYSLSSRSWLEGLMLSADSSTTPALAASTHIANTTRSFILL 18 V++LL ++S R L SA S+ T A S HIA ++ ILL Sbjct: 118 VQLLLCNISDRDIFVKLRCSAASNITALPAGSGHIAPKSQMRILL 162 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,497,162 Number of Sequences: 27780 Number of extensions: 319317 Number of successful extensions: 1062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -