BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1453 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58764| Best HMM Match : Sex_peptide (HMM E-Value=5.7) 28 9.0 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 28 9.0 >SB_58764| Best HMM Match : Sex_peptide (HMM E-Value=5.7) Length = 418 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 638 NLVQGPFSIKQRSSDSKQIPHIKFDRSETSSRLKTSLGMIEKLLTLKN 495 NL P +IK+ + S +PH+++ S LK + IEK+ N Sbjct: 159 NLSNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVTACDN 206 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -1 Query: 638 NLVQGPFSIKQRSSDSKQIPHIKFDRSETSSRLKTSLGMIEKLLTLKNC 492 NL P +IK+ + S +PH+++ S LK + IEK+ C Sbjct: 377 NLSNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGC 425 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,121,123 Number of Sequences: 59808 Number of extensions: 295208 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -