BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1450 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 27 0.41 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 27 0.71 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 26 0.94 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 26 0.94 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 2.2 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 25 2.9 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 3.8 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.8 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 3.8 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.6 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 23 6.6 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 6.6 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 6.6 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 6.6 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 8.8 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 8.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.8 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 8.8 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 8.8 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 8.8 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 8.8 AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 23 8.8 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 8.8 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 8.8 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.8 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 8.8 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 8.8 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.8 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 8.8 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.8 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.8 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 8.8 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 8.8 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 8.8 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 8.8 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.8 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 27.5 bits (58), Expect = 0.41 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 158 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQILFTCLVTNRKTS 289 EM +LD ++KE K+P + R +YQ+ T V TS Sbjct: 292 EMNYLDQILKESLRKYPPVPVHFRETSKEYQVPGTKTVLEAGTS 335 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 26.6 bits (56), Expect = 0.71 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 426 FPLKQKQPEDSKRPVAEPTE-TTSTNVSRRRWSSPPRAT 539 F K++Q + ++ +AEP E TTS++ S R +PP+ T Sbjct: 563 FYRKEQQQQQLQQTLAEPKEQTTSSSPSNNR-LTPPKGT 600 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.2 bits (55), Expect = 0.94 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAWR-QPRRP 581 +PT TT+T + W+ P + T T+ W QPR P Sbjct: 149 DPTITTTTPI----WTDPTTWSAPTTTTTWSDQPRPP 181 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 +PT T S + WS PR T T+ W P Sbjct: 161 DPT-TWSAPTTTTTWSDQPRPPTTTTTTVWTDP 192 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNV--SRRRWSSPPRATCGTLTSAWRQP 572 +PT TT+T+ + WS P T T+ W P Sbjct: 191 DPTATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDP 225 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.2 bits (55), Expect = 0.94 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAWR-QPRRP 581 +PT TT+T + W+ P + T T+ W QPR P Sbjct: 149 DPTITTTTPI----WTDPTTWSAPTTTTTWSDQPRPP 181 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAW 563 +PT T S + WS PR T T+ W Sbjct: 161 DPT-TWSAPTTTTTWSDQPRPPTTTTTTVW 189 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +2 Query: 155 NEMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 253 ++M++LD ++KE K+P + R+ Y++ Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYRV 382 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 24.6 bits (51), Expect = 2.9 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 83 HYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLK 202 +Y P SPY R ML +L L+ +Q +D +MK+ L+ Sbjct: 4 YYHPASPYCRSVMLVAKAL--KLSLNLQFVD-LMKDEQLR 40 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.8 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNVSRRR--WSSPPRATCGTLTSAWRQP 572 +PT TT+T S WS P T T+ W P Sbjct: 190 DPTATTTTPASTTTTTWSDLPPPPPTTTTTVWIDP 224 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/36 (30%), Positives = 13/36 (36%) Frame = +3 Query: 465 PVAEPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 PV T S + WS P T T+ W P Sbjct: 156 PVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDP 191 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.8 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNVSRRR--WSSPPRATCGTLTSAWRQP 572 +PT TT+T S WS P T T+ W P Sbjct: 190 DPTATTTTPASTTTTTWSDLPPPPPTTTTTVWIDP 224 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/36 (30%), Positives = 13/36 (36%) Frame = +3 Query: 465 PVAEPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 PV T S + WS P T T+ W P Sbjct: 156 PVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDP 191 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNV--SRRRWSSPPRATCGTLTSAWRQP 572 +PT TT+T+ + WS P T T+ W P Sbjct: 191 DPTATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDP 225 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/36 (30%), Positives = 13/36 (36%) Frame = +3 Query: 465 PVAEPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 PV T S + WS P T T+ W P Sbjct: 157 PVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDP 192 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +3 Query: 222 KDAWKATSIRYYSPAWLRT 278 ++ WK YY WL T Sbjct: 12 EEGWKLNRTNYYQEGWLAT 30 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 23.4 bits (48), Expect = 6.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 158 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 253 EM++LD ++ E K+P + RV Y + Sbjct: 352 EMKYLDQILNESLRKYPPVPVHLRVASKDYHV 383 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.4 bits (48), Expect = 6.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 149 LANEMQHLDNMMKELSLKFPSIINEGR 229 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMIGR 80 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.4 bits (48), Expect = 6.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 149 LANEMQHLDNMMKELSLKFPSIINEGR 229 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMFGR 80 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 244 VSDIIHLPGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWD 375 V I+ P Y+ +I+ +L + ++ FN Y++ LP+D Sbjct: 193 VESIVPHPEYDMHNISRPNDICILRLASDVTFNDYVRPICLPFD 236 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 573 RRPMRSRKCRSDHVRCHIRDDAEFL 647 RRP + RK + HV IR E L Sbjct: 106 RRPRKVRKLQHHHVEARIRFAEEHL 130 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +2 Query: 68 HWPYHHYDPFSPYV--RESMLDTHS 136 HW +HH S YV R +L+T++ Sbjct: 298 HWQHHHSHHRSAYVQNRVQLLETNT 322 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 128 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 235 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1486 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1521 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 128 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 235 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1487 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1522 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 +PT T S + WS P T T+ W P Sbjct: 161 DPT-TWSAPTTTTTWSDQPPPPTTTTTTVWTDP 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNV--SRRRWSSPPRATCGTLTSAWRQP 572 +PT TT+T + WS P T T+ W P Sbjct: 191 DPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDP 225 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 474 EPTETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 +PT T S + WS P T T+ W P Sbjct: 161 DPT-TWSAPTTTTTWSDQPPPPTTTTTTVWTDP 192 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 474 EPTETTSTNV--SRRRWSSPPRATCGTLTSAWRQP 572 +PT TT+T + WS P T T+ W P Sbjct: 191 DPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDP 225 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +3 Query: 480 TETTSTNVSRRRWSSPPRATCGTLTSAWRQP 572 T TT + + WS P T T+ W P Sbjct: 195 TTTTPASTTTTTWSDLPPPPPTTTTTVWIDP 225 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 149 LANEMQHLDNMMKELSLKFPSIINEGR 229 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPLFGR 80 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.0 bits (47), Expect = 8.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 161 MQHLDNMMKELSLKFPSIINEGRVEGDKYQILFTCLVTNRKT 286 +++LDN++ E K+P + + RV Y I T V ++T Sbjct: 363 IKYLDNVIDETLRKYPPVESLTRVPSVDYLIPGTKHVIPKRT 404 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.0 bits (47), Expect = 8.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 7 SVVRTAGGGLGRATVLPWLVTLAVSPLRPLQS 102 S V A GL T PWLVT + S L+ S Sbjct: 83 SSVGGAQSGLPDITRHPWLVTASQSALQKFAS 114 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 169 LGQHDEGAVVEVPQHYKRRTRGRRQVSDIIH 261 +G H A + +PQH+ ++G+ + +H Sbjct: 149 MGHHMGTAQMTIPQHHMGHSQGQECYPEQVH 179 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 56 HGSSHWPYHHY 88 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 656 WNRQELRIVSDVTAYVVASTLSRSH 582 W R L++ + T V+ S+L R H Sbjct: 692 WMRHHLQLAPEKTECVMISSLRRGH 716 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,760 Number of Sequences: 2352 Number of extensions: 15463 Number of successful extensions: 126 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -