BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1445 (779 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0103 + 1253613-1253783,1253994-1254758,1254860-1255228 28 7.2 06_03_0098 - 16621473-16621511,16621617-16621655,16621741-166220... 28 9.6 >10_01_0103 + 1253613-1253783,1253994-1254758,1254860-1255228 Length = 434 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 646 YIIMSPHHSIIRVFKIYTHYIGRTGIFCGHVDIA 545 Y+ PHH + + + Y G T + C H+D+A Sbjct: 15 YVAACPHHGMEEWVILQSCYNGLTPMSCDHLDVA 48 >06_03_0098 - 16621473-16621511,16621617-16621655,16621741-16622029, 16622112-16622282,16622361-16623244,16623332-16623775, 16623854-16624561 Length = 857 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Frame = -1 Query: 548 CHYETTFIDNNTILWSKFLWSI----SLFYKAGNIDDNQHGRIATANDLIKSQTILHVH* 381 CHY + ID NT W+ +I + + + G + +H + D Q I Sbjct: 751 CHYLNSRIDKNTYDWTPIQLAIDEAWAQYMQRGGLRKTRHDTLIHKKDFPVKQQIGDQCG 810 Query: 380 FYQCH 366 F+ CH Sbjct: 811 FHVCH 815 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,116,033 Number of Sequences: 37544 Number of extensions: 369532 Number of successful extensions: 836 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -