BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1441 (363 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D8A0D0 Cluster: hypothetical protein e1116g03.tm... 32 2.7 UniRef50_A0GEG1 Cluster: Type II secretion system protein; n=4; ... 31 4.8 UniRef50_Q6CW51 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 31 4.8 UniRef50_A4F3L5 Cluster: Putative uncharacterized protein ORF9; ... 31 6.3 UniRef50_A0CL92 Cluster: Chromosome undetermined scaffold_20, wh... 31 6.3 >UniRef50_UPI0000D8A0D0 Cluster: hypothetical protein e1116g03.tmp0186; n=1; Eimeria tenella|Rep: hypothetical protein e1116g03.tmp0186 - Eimeria tenella Length = 729 Score = 32.3 bits (70), Expect = 2.7 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = -1 Query: 183 KT*SVVMCDNLTFKFFSLPFWSTI*QAKSKNGRHTNKFKSEVITHNNRSSLFCTGNVNEY 4 +T S C N+ ++F S P W Q ++ RH + +S++ + + NVN + Sbjct: 229 RTQSSAACGNVNYRFISRPMWKITQQQRAHQKRHLQQQRSKICPGWVETRIPLVTNVNSH 288 >UniRef50_A0GEG1 Cluster: Type II secretion system protein; n=4; Burkholderiaceae|Rep: Type II secretion system protein - Burkholderia phytofirmans PsJN Length = 293 Score = 31.5 bits (68), Expect = 4.8 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = -2 Query: 179 LDRLLCVITSLLNFFLFHFGQQFNKLSPKMVDIQTNLKVRLSHITTDQVFSALGMLMNI 3 L + L V+ L+NF + HFG +F++ + D+Q L L+ + F AL ++ ++ Sbjct: 42 LPKSLRVLWPLVNFVVHHFGGKFSRKLVEKTDLQLRL-TSLTFLMNAHQFIALSIIASV 99 >UniRef50_Q6CW51 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome B of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome B of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 297 Score = 31.5 bits (68), Expect = 4.8 Identities = 16/41 (39%), Positives = 29/41 (70%) Frame = +2 Query: 5 YSLTFPVQKRLDRLLCVITSLLNLFVCLPFLDLAC*IVDQN 127 ++L + + KR+ R+L +ITS +++F+ L FL + C VDQ+ Sbjct: 5 FTLFYKLGKRIPRVLVLITSFISVFL-LVFLLVGCYNVDQS 44 >UniRef50_A4F3L5 Cluster: Putative uncharacterized protein ORF9; n=1; Planktothrix agardhii NIVA-CYA 126|Rep: Putative uncharacterized protein ORF9 - Planktothrix agardhii NIVA-CYA 126 Length = 267 Score = 31.1 bits (67), Expect = 6.3 Identities = 12/52 (23%), Positives = 28/52 (53%) Frame = -2 Query: 203 LTFPVQKRLDRLLCVITSLLNFFLFHFGQQFNKLSPKMVDIQTNLKVRLSHI 48 + + + + + +L + T L N + QQ NK+S + ++++ N L+H+ Sbjct: 188 ILWSISQTISIILIIYTILGNILSTYITQQLNKISKQQLEMEANYNYALTHV 239 >UniRef50_A0CL92 Cluster: Chromosome undetermined scaffold_20, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_20, whole genome shotgun sequence - Paramecium tetraurelia Length = 473 Score = 31.1 bits (67), Expect = 6.3 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +2 Query: 56 ITSLLNLFVCLPFLDLAC*IVDQNGREKNLKVRLSHITTDQ 178 + S+LNL+ F D+ +++QN +E L R+ HIT D+ Sbjct: 375 LVSILNLYYIRAFQDMP--LINQNIQEDQLYTRMIHITPDE 413 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 319,708,012 Number of Sequences: 1657284 Number of extensions: 5594582 Number of successful extensions: 11045 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11043 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 12794443530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -