BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1438 (630 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537543-1|CAD97778.1| 161|Homo sapiens hypothetical protein pr... 52 2e-06 BC101969-1|AAI01970.1| 161|Homo sapiens LPS-induced TNF-alpha f... 52 2e-06 BC101402-1|AAI01403.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC101401-1|AAI01402.1| 161|Homo sapiens LPS-induced TNF-alpha f... 52 2e-06 BC096066-1|AAH96066.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC096065-1|AAH96065.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC096063-1|AAH96063.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC046154-1|AAH46154.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC039840-1|AAH39840.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC016491-1|AAH16491.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC008309-1|AAH08309.1| 161|Homo sapiens lipopolysaccharide-indu... 52 2e-06 BC000053-1|AAH00053.1| 161|Homo sapiens LITAF protein protein. 52 2e-06 AB034747-1|BAB32547.1| 161|Homo sapiens small integral membrane... 52 2e-06 DQ167023-1|AAZ94626.1| 208|Homo sapiens cell death inducing pro... 37 0.051 CR533446-1|CAG38477.1| 208|Homo sapiens C16orf5 protein. 37 0.051 BC007604-1|AAH07604.1| 125|Homo sapiens Unknown (protein for IM... 37 0.051 BC002882-1|AAH02882.1| 208|Homo sapiens chromosome 16 open read... 37 0.051 AF195661-1|AAG35583.1| 208|Homo sapiens transmembrane protein I... 37 0.051 D50406-1|BAA34060.1| 971|Homo sapiens ST15 protein. 30 5.9 AL158830-3|CAD13384.2| 971|Homo sapiens reversion-inducing-cyst... 30 5.9 AL138834-5|CAH70155.1| 971|Homo sapiens reversion-inducing-cyst... 30 5.9 >BX537543-1|CAD97778.1| 161|Homo sapiens hypothetical protein protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101969-1|AAI01970.1| 161|Homo sapiens LPS-induced TNF-alpha factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101402-1|AAI01403.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101401-1|AAI01402.1| 161|Homo sapiens LPS-induced TNF-alpha factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096066-1|AAH96066.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096065-1|AAH96065.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096063-1|AAH96063.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC046154-1|AAH46154.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC039840-1|AAH39840.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC016491-1|AAH16491.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC008309-1|AAH08309.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC000053-1|AAH00053.1| 161|Homo sapiens LITAF protein protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >AB034747-1|BAB32547.1| 161|Homo sapiens small integral membrane protein of lysosome/late endosome protein. Length = 161 Score = 52.0 bits (119), Expect = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 19 VAPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 +A C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 128 IAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >DQ167023-1|AAZ94626.1| 208|Homo sapiens cell death inducing protein protein. Length = 208 Score = 37.1 bits (82), Expect = 0.051 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 28 CACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 C IP + KD H CP+C AYI +Y R Sbjct: 177 CCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >CR533446-1|CAG38477.1| 208|Homo sapiens C16orf5 protein. Length = 208 Score = 37.1 bits (82), Expect = 0.051 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 28 CACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 C IP + KD H CP+C AYI +Y R Sbjct: 177 CCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >BC007604-1|AAH07604.1| 125|Homo sapiens Unknown (protein for IMAGE:3350242) protein. Length = 125 Score = 37.1 bits (82), Expect = 0.051 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 28 CACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 C IP + KD H CP+C AYI +Y R Sbjct: 94 CCLIPCLINDFKDVTHTCPSCKAYIYTYKR 123 >BC002882-1|AAH02882.1| 208|Homo sapiens chromosome 16 open reading frame 5 protein. Length = 208 Score = 37.1 bits (82), Expect = 0.051 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 28 CACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 C IP + KD H CP+C AYI +Y R Sbjct: 177 CCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >AF195661-1|AAG35583.1| 208|Homo sapiens transmembrane protein I1 protein. Length = 208 Score = 37.1 bits (82), Expect = 0.051 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 28 CACIPYCTDSCKDANHYCPNCNAYIGSYNR 117 C IP + KD H CP+C AYI +Y R Sbjct: 177 CCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >D50406-1|BAA34060.1| 971|Homo sapiens ST15 protein. Length = 971 Score = 30.3 bits (65), Expect = 5.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 112 CSFQCTRCNSDSNGLHLCRSPCSKGYKHMGQQ 17 CS Q C+S S G +C+S C + K G Q Sbjct: 415 CSLQIKPCHSKSRGSIICKSDCVEILKKCGDQ 446 >AL158830-3|CAD13384.2| 971|Homo sapiens reversion-inducing-cysteine-rich protein with kazal motifs protein. Length = 971 Score = 30.3 bits (65), Expect = 5.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 112 CSFQCTRCNSDSNGLHLCRSPCSKGYKHMGQQ 17 CS Q C+S S G +C+S C + K G Q Sbjct: 415 CSLQIKPCHSKSRGSIICKSDCVEILKKCGDQ 446 >AL138834-5|CAH70155.1| 971|Homo sapiens reversion-inducing-cysteine-rich protein with kazal motifs protein. Length = 971 Score = 30.3 bits (65), Expect = 5.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 112 CSFQCTRCNSDSNGLHLCRSPCSKGYKHMGQQ 17 CS Q C+S S G +C+S C + K G Q Sbjct: 415 CSLQIKPCHSKSRGSIICKSDCVEILKKCGDQ 446 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,333,047 Number of Sequences: 237096 Number of extensions: 1495755 Number of successful extensions: 2997 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2997 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6860268620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -