BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1438 (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.4 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 4.3 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 4.3 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 514 LRYLNITPVSCIFVYFLITFI*LMYFITLCKRI 612 +R LNI VS +F FL + + Y+I + I Sbjct: 396 MRALNIDRVSRVFFPFLFAVLNVTYWIMFAEYI 428 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 597 CNKIH*LNKCDQE 559 CNKI+ L KC QE Sbjct: 123 CNKIYNLAKCVQE 135 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 597 CNKIH*LNKCDQE 559 CNKI+ L KC QE Sbjct: 123 CNKIYNLAKCVQE 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,728 Number of Sequences: 438 Number of extensions: 2896 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -