BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1437 (680 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8PSW0 Cluster: UPF0282 protein MM_2966; n=1; Methanosa... 36 0.91 >UniRef50_Q8PSW0 Cluster: UPF0282 protein MM_2966; n=1; Methanosarcina mazei|Rep: UPF0282 protein MM_2966 - Methanosarcina mazei (Methanosarcina frisia) Length = 303 Score = 35.9 bits (79), Expect = 0.91 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +1 Query: 196 TDIPHLYFVILYWPPQNSTTHQLPTIAFDDLRKISLKCKTGRNVTVLQYRKRKHFIHY 369 TDI ++ + P + +QLP A DL+ + CK N++ L R+RK F Y Sbjct: 67 TDIVISHYHGDHMPMKAEDPYQLPVEALPDLKGVRFWCKGPGNISGLSARRRKEFFRY 124 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,607,557 Number of Sequences: 1657284 Number of extensions: 10186656 Number of successful extensions: 17215 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17211 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52892566912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -