BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1437 (680 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-453|AAF59228.1| 3242|Drosophila melanogaster CG2093-PA ... 30 2.5 AE013599-3622|AAF47022.3| 406|Drosophila melanogaster CG33150-P... 29 7.8 >AE013599-453|AAF59228.1| 3242|Drosophila melanogaster CG2093-PA protein. Length = 3242 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 25/31 (80%) Frame = -3 Query: 108 QLTVDYNWMVEIKF*KALI*ESLNNVITFKL 16 +LT++ N ++EI++ K L+ +S+N+V T+KL Sbjct: 2632 ELTINENALLEIEYQKYLVHKSVNDVQTYKL 2662 >AE013599-3622|AAF47022.3| 406|Drosophila melanogaster CG33150-PA protein. Length = 406 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 260 SFQLSLLMIFVKLV*NVKLVEMLLFFNIENVSIS 361 +FQ S+L++FV N LV L++ IEN S++ Sbjct: 256 TFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMA 289 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,767,325 Number of Sequences: 53049 Number of extensions: 433904 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -