BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1432 (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 30 1.6 At1g76965.1 68414.m08961 glycine-rich protein 29 2.1 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.7 At5g42370.1 68418.m05159 expressed protein 29 3.7 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.7 At5g16970.1 68418.m01988 NADP-dependent oxidoreductase, putative... 28 4.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 4.9 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 6.5 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 6.5 At5g22390.1 68418.m02612 expressed protein 27 8.6 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 27 8.6 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 586 RVRIQSET*DDFRECHIKYIQFLRPHI 506 R+RIQ DF + + K+++FL PHI Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPHI 198 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 455 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 360 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 242 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 108 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 181 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 71 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 44 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 175 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g16970.1 68418.m01988 NADP-dependent oxidoreductase, putative (P1) identical to probable NADP-dependent oxidoreductase P1, zeta-crystallin homolog [SP|Q39172][gi:886428], Arabidopsis thaliana; similar to allyl alcohol dehydrogenase [Nicotiana tabacum] GI:6692816; contains Pfam profile PF00107: oxidoreductase, zinc-binding dehydrogenase family Length = 345 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 586 RVRIQSET*DDFRECHIKYIQFLRPHI 506 R+RIQ DF + + K+++F+ PHI Sbjct: 278 RIRIQGFVVSDFYDKYSKFLEFVLPHI 304 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 237 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 139 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 464 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 345 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 464 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 345 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 116 ERSGKSFLFCLSVRVPWNPIEG 181 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 586 RVRIQSET*DDFRECHIKYIQFLRPHI 506 R+RIQ DF E + K++ F+ PHI Sbjct: 278 RIRIQGFAVFDFYEKYSKFLDFVLPHI 304 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,000,299 Number of Sequences: 28952 Number of extensions: 357370 Number of successful extensions: 1060 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -