BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1427 (581 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 25 0.35 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.5 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 7.6 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 7.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 25.4 bits (53), Expect = 0.35 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 581 SRGSFKRRRAFPPRHHSARLERNTGARRYYRPRTASAQPSK 459 SRG + R+ R E T YYRPRT+ +P + Sbjct: 206 SRGRHNQSRS--KRQPKTGREDQTRRNPYYRPRTSRTEPPR 244 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 422 SSLKNHYFHCFITYSVGRK 478 SS +FHC+ GRK Sbjct: 416 SSFFQQFFHCYCPIKFGRK 434 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 542 RHHSARLERNTGARRYYRPRTA 477 R H +ER GA R RTA Sbjct: 70 RSHEPEMERPKGASNGKRARTA 91 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 542 RHHSARLERNTGARRYYRPRTA 477 R H +ER GA R RTA Sbjct: 90 RSHEPEMERPKGASNGKRARTA 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,522 Number of Sequences: 336 Number of extensions: 2670 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -