BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1421 (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|ch... 28 1.2 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.6 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 26 6.3 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 8.3 SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub... 25 8.3 >SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 679 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = +2 Query: 398 MGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATSQYPCGNFSGTSC*KLFILKDR*AV 577 +GE ++ W +L S + K +R LAA P N ++ + DR V Sbjct: 401 VGENNDFWNRMLHRSHLSTMAALHKSQRSHDLAANEHAPILNPKNSALNPRLVTNDRVKV 460 Query: 578 LSQSL 592 S SL Sbjct: 461 KSPSL 465 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 702 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 568 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = -1 Query: 264 RPSAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 130 + A A+ +A A +AEA E+ K+++ EP+++ +K+ Sbjct: 86 KAKAAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 585 SPYAY*TSGSSQLLPFCSTRGF 650 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 276 GSCTRPSAGGAKLPSAGLCLNASKAEASLAESGKDM 169 G+ P+AGGA A +K E + ES +DM Sbjct: 69 GAVATPAAGGAAGAEATSAAEEAKEEEAAEESDEDM 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,013,342 Number of Sequences: 5004 Number of extensions: 61984 Number of successful extensions: 168 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -