BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1421 (723 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 25 2.4 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 25 2.4 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 9.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 9.6 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 597 THRDCESTAYRSFSIKSF*QEVPEKLPQGYWLVAAK 490 THRDC S + SFS K VP +G+ V K Sbjct: 37 THRDCCSGSCLSFSYKCV--PVPASASEGFISVPVK 70 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 416 AWRILLRNDRKSRHRRIKKQRRYERLAATSQY 511 AWR L+ R S R K+ AAT QY Sbjct: 2 AWRTLMLRSRGSTERLCAKRYENTVAAATKQY 33 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 159 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSM 52 + R GSK S + S+ E RR+P RSM Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSM 141 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 209 EAFRHNPADGSFAPPALGRV 268 E +RH P +G++A + GRV Sbjct: 35 ELYRHPPNNGNWAVDSSGRV 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,082 Number of Sequences: 2352 Number of extensions: 14941 Number of successful extensions: 37 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -