BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1419 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50797| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-30) 32 0.40 SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_50797| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-30) Length = 308 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = -1 Query: 635 IWGFSIICQIKSVI*ISDKVLHEETLLHFVITKILLLITKMYIINEI*VTILFIELF 465 +W FS+ + +I I D+ + E+T++ I ++ + II I +TI++I +F Sbjct: 136 MWVFSLAASLVQLIWIKDETISEDTIILIEIIYDIISFGIVVIIPLIIITIIYIAIF 192 >SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 289 FMLEKYFVL-LKLDLICGMLSCPIFCNFYK 375 F++E V LDL+ LSCPI C+F K Sbjct: 232 FVIEAVSVTWFTLDLVLRFLSCPIKCDFLK 261 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,868,497 Number of Sequences: 59808 Number of extensions: 316050 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -