BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1419 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 25 0.53 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 2.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 2.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 6.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.7 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 25.4 bits (53), Expect = 0.53 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 566 ETLLHFVITKILLLITKMYIINEI 495 +T +H ITKI ITK IN+I Sbjct: 109 DTNVHLKITKIFQCITKFKTINDI 132 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = +1 Query: 259 EIVKHMNVTKFMLEKYF 309 ++VK++++ +F LEK+F Sbjct: 199 QVVKNLHLPRFTLEKFF 215 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = +1 Query: 259 EIVKHMNVTKFMLEKYF 309 ++VK++++ +F LEK+F Sbjct: 199 QVVKNLHLPRFTLEKFF 215 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 6.6 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -1 Query: 359 KIGQLNIPQIKSSFKRTKYFSSMNLVTFICFTISAVYDYLTNNLITTCRY 210 K+ +LN + ++R ++ LVT I I V L N L+ Y Sbjct: 42 KMRELNATACAALYERVEWSGPWILVTLIVLAIVNVMVVLGNVLVILAVY 91 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 182 KWCSNVESAYTCMWLLNCWLNNHTR 256 K C + +T +WL WL N T+ Sbjct: 215 KMCDILHLRHTKIWLRPDWLFNLTK 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,727 Number of Sequences: 438 Number of extensions: 3860 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -