BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1414 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 1.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 7.0 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/67 (19%), Positives = 30/67 (44%) Frame = -3 Query: 312 YINTYNSILTSNSRFYEVF*LYIYNIDNAKFLFYYFQKEYVLLELVIINIKNKKSVFIAI 133 Y N S++ +R + L + + + LF+ +++ ++I IK ++S + Sbjct: 197 YENKNGSVILDTARCSMKWTLIEHAFEISTMLFFVLPMTIIIVLYILIAIKLRRSRMLTA 256 Query: 132 LTNNNKI 112 N N + Sbjct: 257 TVNRNHL 263 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 607 IFLYIQGCLSYFSGIIYY 660 + + I L+Y SG+ YY Sbjct: 321 VLIIIYTILTYMSGVFYY 338 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 245 FTTLIMPNFYFTIFRKSMCFWS 180 F +IMPN Y IF +S Sbjct: 130 FHNIIMPNVYIRIFPNGSVLYS 151 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 245 FTTLIMPNFYFTIFRKSMCFWS 180 F +IMPN Y IF +S Sbjct: 130 FHNIIMPNVYIRIFPNGSVLYS 151 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +1 Query: 229 IINVVNVKLKNFIKS*VACQY*IVG 303 + N++++K +N K + C+ I+G Sbjct: 327 LYNLMSIKYRNAFKQTICCKTRIIG 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,487 Number of Sequences: 438 Number of extensions: 4507 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -