BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1407 (644 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 4e-17 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 84 1e-16 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 82 4e-16 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 81 8e-16 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 1e-15 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 80 2e-15 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 80 2e-15 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 79 2e-15 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 79 2e-15 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 2e-15 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 2e-15 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 9e-15 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 77 1e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 71 6e-13 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 56 2e-08 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 53 2e-07 SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 48 9e-06 SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 44 1e-04 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 44 1e-04 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_48576| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_47352| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_46792| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_42469| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 42 6e-04 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 85.8 bits (203), Expect = 3e-17 Identities = 41/64 (64%), Positives = 46/64 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG + +GH Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGRRERTGH 96 Query: 188 RRKC 177 +KC Sbjct: 97 HKKC 100 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.4 bits (202), Expect = 4e-17 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ + + +P + F+G + +GH Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDGHE-NQCLPRI-FKGRRERTGH 96 Query: 188 RRKCGAL 168 +KCGAL Sbjct: 97 HKKCGAL 103 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 83.8 bits (198), Expect = 1e-16 Identities = 42/72 (58%), Positives = 48/72 (66%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSRAHRT 96 Query: 188 RRKCGALRVPNH 153 ++ G +R +H Sbjct: 97 PQETGRMRPYDH 108 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 81.8 bits (193), Expect = 4e-16 Identities = 43/76 (56%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -1 Query: 425 RPGTGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERR 249 RP GR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R Sbjct: 20 RPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRT 79 Query: 248 DISTYIPHLNFQGPQR 201 S P NFQGP R Sbjct: 80 RKSMSSP--NFQGPSR 93 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 81.8 bits (193), Expect = 4e-16 Identities = 43/73 (58%), Positives = 47/73 (64%) Frame = -1 Query: 419 GTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDIS 240 G G + P P + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S Sbjct: 238 GPGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKS 296 Query: 239 TYIPHLNFQGPQR 201 P NFQGP R Sbjct: 297 MSSP--NFQGPSR 307 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.8 bits (193), Expect = 4e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSFP--NFQGPSR 92 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/75 (53%), Positives = 48/75 (64%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P + + + GH Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSFPEFS-RVVESAPGH 97 Query: 188 RRKCGALRVPNHISL 144 +KCG H++L Sbjct: 98 HKKCGGF--TEHLTL 110 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 80.6 bits (190), Expect = 1e-15 Identities = 39/56 (69%), Positives = 42/56 (75%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL+PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 80.2 bits (189), Expect = 1e-15 Identities = 43/67 (64%), Positives = 45/67 (67%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R H Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR--AH 233 Query: 188 RRKCGAL 168 R AL Sbjct: 234 RTPQEAL 240 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 80.2 bits (189), Expect = 1e-15 Identities = 43/75 (57%), Positives = 47/75 (62%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R H Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR--AH 83 Query: 188 RRKCGALRVPNHISL 144 R H++L Sbjct: 84 RTPQEVWCFTEHLTL 98 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 165 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 87 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 165 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 165 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 99 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 234 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 102 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 204 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 165 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 111 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 164 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 165 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 60 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 113 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 203 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 99 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 203 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 190 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 131 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 130 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 81 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 79.4 bits (187), Expect = 2e-15 Identities = 55/108 (50%), Positives = 61/108 (56%), Gaps = 1/108 (0%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR---- 92 Query: 188 RRKCGALRVPNHISLL*DSMELERS-GRKENSSRTSRRRLQATLGYPV 48 A R P E E S RKENSS+ R+RL+ L Y + Sbjct: 93 -----AHRTP---------QEGESSLKRKENSSQGPRQRLRVRLRYRI 126 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/56 (69%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 79.4 bits (187), Expect = 2e-15 Identities = 40/71 (56%), Positives = 46/71 (64%) Frame = -1 Query: 413 GRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTY 234 GR+ + + +PIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S Sbjct: 23 GRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 82 Query: 233 IPHLNFQGPQR 201 P NFQGP R Sbjct: 83 SP--NFQGPSR 91 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = -3 Query: 378 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTARHLHVHPSPEFSRSAES 199 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR+ VR ++V PEFSR+ ES Sbjct: 77 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVRPDTKINVF--PEFSRAVES 134 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.0 bits (186), Expect = 3e-15 Identities = 39/56 (69%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTRKSMSSP--NFQGPSR 92 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.6 bits (185), Expect = 4e-15 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL KLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 78.6 bits (185), Expect = 4e-15 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH +I+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 105 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 5e-15 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI F DFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 78.2 bits (184), Expect = 5e-15 Identities = 39/57 (68%), Positives = 41/57 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRV 198 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG RV Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSRV 132 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 77.8 bits (183), Expect = 7e-15 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 77.8 bits (183), Expect = 7e-15 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 +S EPIL KLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 77.4 bits (182), Expect = 9e-15 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL LETCCGY Y+R S P NFQGP R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDRTRKSMSSP--NFQGPSR 92 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 77.0 bits (181), Expect = 1e-14 Identities = 42/67 (62%), Positives = 44/67 (65%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R H Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR--AH 246 Query: 188 RRKCGAL 168 R AL Sbjct: 247 RTPQEAL 253 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 77.0 bits (181), Expect = 1e-14 Identities = 39/63 (61%), Positives = 42/63 (66%) Frame = -1 Query: 389 PDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQG 210 P + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQG 141 Query: 209 PQR 201 R Sbjct: 142 SSR 144 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 93 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 93 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 81 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 81 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 81 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 76.6 bits (180), Expect = 2e-14 Identities = 37/69 (53%), Positives = 44/69 (63%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGH 189 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P++ F P + Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPNIEFLQPGGSTRS 98 Query: 188 RRKCGALRV 162 R A+ + Sbjct: 99 RASAAAVEL 107 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 81 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 92 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 76.2 bits (179), Expect = 2e-14 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQ 204 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG Q Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGRQ 91 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 74.9 bits (176), Expect = 5e-14 Identities = 37/53 (69%), Positives = 39/53 (73%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQG 210 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQG 89 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.5 bits (175), Expect = 7e-14 Identities = 37/56 (66%), Positives = 40/56 (71%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P +FQG R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--DFQGSSR 92 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 74.5 bits (175), Expect = 7e-14 Identities = 37/56 (66%), Positives = 39/56 (69%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P NF G R Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFSGASR 81 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 71.3 bits (167), Expect = 6e-13 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPH 225 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R S P+ Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPN 781 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 70.9 bits (166), Expect = 8e-13 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYER 252 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 70.9 bits (166), Expect = 8e-13 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 377 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYER 252 +S +PIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+R Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 68.9 bits (161), Expect = 3e-12 Identities = 36/67 (53%), Positives = 42/67 (62%) Frame = -1 Query: 401 FPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHL 222 F ++ P + P +LRI FADFPYLH SI+ RL TLETCCGY Y+R S P Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP-- 57 Query: 221 NFQGPQR 201 NFQGP R Sbjct: 58 NFQGPSR 64 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -1 Query: 347 LRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 LRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -1 Query: 347 LRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 LRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -1 Query: 347 LRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 LRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 48 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -1 Query: 347 LRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 LRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 378 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLR 268 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR Sbjct: 37 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.7 bits (148), Expect = 1e-10 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = -1 Query: 341 IQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 I FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 48 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = -1 Query: 341 IQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 I FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 54 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 353 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 P++ FADFPYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 378 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRI-WVRTARHLHVHPSPEFSRSAE 202 P LRANP+ EVTD P L L + RT + + SP F + Sbjct: 37 PTLRANPFPEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM---SSPNFQGPSR 93 Query: 201 SIRTPPQMRC 172 + RTP ++ C Sbjct: 94 AHRTPQEVWC 103 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 3e-10 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = -1 Query: 347 LRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQG 210 LRI FADFPYLH SI+ RL TLETCCGY Y+R S P NFQG Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCGYEYDRTRKSMSSP--NFQG 44 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 56.0 bits (129), Expect = 2e-08 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -1 Query: 353 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 P++ F PYLH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 149 PEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 197 Score = 35.9 bits (79), Expect = 0.028 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = -3 Query: 378 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRI-WVRTARHLHVHPSPEFSRSAE 202 P LRANP+ EVTD CRLP L L + RT + + SP F + Sbjct: 141 PTLRANPFPEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTRKSM---SSPNFQGPSR 197 Query: 201 SIRTPPQMRCSSR 163 + RTP ++ R Sbjct: 198 AHRTPQEICTGGR 210 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S P NFQG + +GH +KCGAL Sbjct: 107 RLLTLETCCGYEYDRTRKSMSSP--NFQGRRERTGHHKKCGAL 147 >SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S P NFQG + +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFQGRRERTGHHKKCGAL 41 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/51 (52%), Positives = 31/51 (60%) Frame = -1 Query: 353 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYERRDISTYIPHLNFQGPQR 201 P++ F P LH SI+ RL TLETCCGY Y+R S P NFQGP R Sbjct: 45 PEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = -3 Query: 378 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRI-WVRTARHLHVHPSPEFSRSAE 202 P LRANP+ EVTD CRLPL L L + RT + + SP F + Sbjct: 37 PTLRANPFPEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTRKSM---SSPNFQGPSR 93 Query: 201 SIRTPPQMRC 172 + RTP ++ C Sbjct: 94 AHRTPQEVWC 103 >SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 51.6 bits (118), Expect = 5e-07 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S P NF+G + +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFKGRRERTGHHKKCGAL 41 >SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S +P + F+G + +GH RKCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSC-LPRI-FKGRRERTGHHRKCGAL 41 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S P FQGP R +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--KFQGPSRAHRTPQKCGAL 41 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 47.6 bits (108), Expect = 9e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -1 Query: 368 EPILIPKLRIQFADFPYLHYSID*RLF--TLETCC 270 EPIL PKLRI FADFPYLH SI+ RL LE+ C Sbjct: 52 EPILFPKLRIYFADFPYLHCSINQRLLGDPLESTC 86 >SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKC 177 RL TLETCCGY Y+R S P NFQG + +GH +KC Sbjct: 1 RLLTLETCCGYEYDRTRKSCLPP--NFQGRRERTGHHKKC 38 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL TLETCCGY Y+R S P + +R +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSFPEFSRAVRER-TGHHKKCGAL 42 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 46.4 bits (105), Expect = 2e-05 Identities = 41/101 (40%), Positives = 49/101 (48%), Gaps = 3/101 (2%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISLL*DSMELER 117 RL TLETCCGY Y+R S P NFQGP R A R P E E Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFQGPSR---------AHRTP---------QEGES 40 Query: 116 S-GRKENSSRTSRRRLQATLGYPV--EHSFLKTRERLLKRF 3 S RKENSS+ R+RL+ L Y + E + + +L RF Sbjct: 41 SLKRKENSSQGPRQRLRVRLRYRICRERQYPRPGSGILTRF 81 >SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = -1 Query: 296 RLFTLETCCGYGYERRDISTYIPHLNFQGPQRVSGHRRKCGAL 168 RL LETCCGY Y+R S P+ + +G + +GH +KCGAL Sbjct: 1 RLLPLETCCGYEYDRTRKSMSSPNFS-RGRRERTGHHKKCGAL 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,681,389 Number of Sequences: 59808 Number of extensions: 479195 Number of successful extensions: 2359 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2336 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -