BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1402 (736 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X75621-1|CAA53287.1| 1807|Homo sapiens tuberin protein. 31 4.3 L48546-1|AAB41564.1| 1807|Homo sapiens tuberin protein. 31 4.3 BC150300-1|AAI50301.1| 1784|Homo sapiens TSC2 protein protein. 31 4.3 AC005600-3|AAC34210.1| 1784|Homo sapiens tuberin protein. 31 4.3 AB210000-1|BAE06082.1| 1775|Homo sapiens SLC9A3R2 variant protei... 31 4.3 >X75621-1|CAA53287.1| 1807|Homo sapiens tuberin protein. Length = 1807 Score = 31.1 bits (67), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 160 LGQKCVNQRPSESLLNLMKYNNNFFKPVRN 249 L ++C +QRP SLLNL+ Y P ++ Sbjct: 410 LVERCADQRPESSLLNLISYRAQSIHPAKD 439 >L48546-1|AAB41564.1| 1807|Homo sapiens tuberin protein. Length = 1807 Score = 31.1 bits (67), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 160 LGQKCVNQRPSESLLNLMKYNNNFFKPVRN 249 L ++C +QRP SLLNL+ Y P ++ Sbjct: 410 LVERCADQRPESSLLNLISYRAQSIHPAKD 439 >BC150300-1|AAI50301.1| 1784|Homo sapiens TSC2 protein protein. Length = 1784 Score = 31.1 bits (67), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 160 LGQKCVNQRPSESLLNLMKYNNNFFKPVRN 249 L ++C +QRP SLLNL+ Y P ++ Sbjct: 410 LVERCADQRPESSLLNLISYRAQSIHPAKD 439 >AC005600-3|AAC34210.1| 1784|Homo sapiens tuberin protein. Length = 1784 Score = 31.1 bits (67), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 160 LGQKCVNQRPSESLLNLMKYNNNFFKPVRN 249 L ++C +QRP SLLNL+ Y P ++ Sbjct: 410 LVERCADQRPESSLLNLISYRAQSIHPAKD 439 >AB210000-1|BAE06082.1| 1775|Homo sapiens SLC9A3R2 variant protein protein. Length = 1775 Score = 31.1 bits (67), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 160 LGQKCVNQRPSESLLNLMKYNNNFFKPVRN 249 L ++C +QRP SLLNL+ Y P ++ Sbjct: 445 LVERCADQRPESSLLNLISYRAQSIHPAKD 474 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,156,203 Number of Sequences: 237096 Number of extensions: 1786452 Number of successful extensions: 2262 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -