BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1402 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.56 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.56 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 24 1.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 2.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.2 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.4 bits (53), Expect = 0.56 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 473 EVNLRLQEFYREKNKHANNNYSTSQI*CILIGFIHPIENAVLARQCEKPGRPL 315 +V L + Y +N +NNN T + I ++ VL R CEK + L Sbjct: 369 DVLLSNNDVYLYQNTMSNNNQRTEWSATVKAA-ISEVQRVVLGRLCEKVAKQL 420 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.4 bits (53), Expect = 0.56 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 473 EVNLRLQEFYREKNKHANNNYSTSQI*CILIGFIHPIENAVLARQCEKPGRPL 315 +V L + Y +N +NNN T + I ++ VL R CEK + L Sbjct: 407 DVLLSNNDVYLYQNTMSNNNQRTEWSATVKAA-ISEVQRVVLGRLCEKVAKQL 458 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 661 IFFFAQNKIAIKVLAIC--TLDLPHVRNVRCIYVFG 560 +FFFA + + V +C T + H R+ C++V G Sbjct: 149 MFFFAATSLLV-VAEVCYFTAHVTHPRHRLCVFVAG 183 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 365 IENAVLARQCEKPGRPLCHH 306 I N+++ Q PG PL H+ Sbjct: 173 IPNSIILDQYTNPGNPLAHY 192 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 518 RTRSLFKLHIVLSTVEVNLRLQEFYRE 438 R ++ KL IVLST+ N R++ +E Sbjct: 491 RKYAMLKLKIVLSTILRNFRVRSDVKE 517 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 109 VEICFFRPAKSYQQGNSLGQKCVNQRPSESLLNLMKY 219 + I F+P K+ ++ ++G K Q S ++ KY Sbjct: 760 IYIILFQPDKNIRRKVTMGDKSKKQGSSAGTSSITKY 796 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 109 VEICFFRPAKSYQQGNSLGQKCVNQRPSESLLNLMKY 219 + I F+P K+ ++ ++G K Q S ++ KY Sbjct: 850 IYIILFQPDKNIRRKVTMGDKSKKQGSSAGTSSITKY 886 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,186 Number of Sequences: 438 Number of extensions: 3966 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -