BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1401 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.65 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 8.0 SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa... 25 8.0 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.65 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 120 SGCGRCRVWSMFVRYVRFSE 179 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 157 TNIDQTRHRPHPLPVQTRHAPV 92 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1049 Score = 25.4 bits (53), Expect = 8.0 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 526 YSRRLPRLLEFLHVDIQSTGQKSHCVNT--REGHRNALF*LDSRIPLVRASSELT 368 Y RL R+L L + ST H ++ R HR A D+R+ +VR SELT Sbjct: 497 YYVRLARILSQLSSEF-STSLVDHARHSFKRMIHRKAKHEYDTRLLIVRYISELT 550 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,896,801 Number of Sequences: 5004 Number of extensions: 59415 Number of successful extensions: 147 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -