BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1401 (709 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 52 6e-07 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 51 1e-06 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 50 2e-06 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 50 2e-06 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 50 2e-06 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 50 2e-06 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 50 2e-06 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 49 3e-06 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 46 3e-05 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 35 0.056 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_58281| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 31 0.69 SB_10665| Best HMM Match : PT (HMM E-Value=6.2) 31 0.92 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 29 3.7 SB_38261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_26554| Best HMM Match : CPSase_L_D3 (HMM E-Value=0) 29 4.9 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 29 4.9 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_36990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 482 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 378 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.4 bits (130), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 708 YNARLESSSTGSSFPADSPKPVPLAVVSLDSR 613 + RLESSSTGSSFPAD KPVPLAVVSLDSR Sbjct: 99 HRVRLESSSTGSSFPADCAKPVPLAVVSLDSR 130 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 97 PVLRANPYSEVTDPICRLPLPTLFYRLEALHL 2 P LRANP+ EVTD CRLPLPTLFY+ EA HL Sbjct: 37 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHL 68 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 97 PVLRANPYSEVTDPICRLPLPTLFYRLEALHL 2 P LRANP+ EVTD CRLPLPTLFY+ EA HL Sbjct: 77 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHL 108 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 552 MPRHLISDAHEWINEIPTVPIYYLAKP 632 MPRHLISDAHEWINEIPTVPI +P Sbjct: 1 MPRHLISDAHEWINEIPTVPIIEFLQP 27 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = -2 Query: 144 RPGTGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 RP GR+ + + EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 20 RPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = -2 Query: 138 GTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 G G + P P + EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 238 GPGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTL 282 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL+PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTL 56 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -2 Query: 108 PDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 P + EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTL 119 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTL 206 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTL 140 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTL 62 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTL 140 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTL 140 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTL 74 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTL 209 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTL 77 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S +PIL PKLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTL 179 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTL 140 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 111 EPILFPKLRIYFADFPYLHCSINQRLLTL 139 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTL 762 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTL 140 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTL 68 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 60 EPILFPKLRIYFADFPYLHCSINQRLLTL 88 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTL 178 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTL 74 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTL 219 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTL 178 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTL 165 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTL 106 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTL 106 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTL 105 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTL 56 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTL 67 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTL 67 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -2 Query: 132 GRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 GR+ + + +PIL PKLRI FADFPYLH SI+ RL TL Sbjct: 23 GRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTL 66 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL KLRI FADFPYLH SI+ RL TL Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTL 67 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH +I+ RL TL Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTL 80 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI F DFPYLH SI+ RL TL Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTL 67 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 96 RSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 +S EPIL KLRI FADFPYLH SI+ RL TL Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTL 67 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RLFTL 1 EPIL PKLRI FADFPYLH SI+ RL L Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKL 67 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 87 EPILIPKLRIQFADFPYLHYSID*RL 10 EPIL PKLRI FADFPYLH SI+ RL Sbjct: 52 EPILFPKLRIYFADFPYLHCSINQRL 77 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/40 (50%), Positives = 25/40 (62%) Frame = -2 Query: 120 FPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTL 1 F ++ P + P +LRI FADFPYLH SI+ RL TL Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTL 39 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 LRIQFADFPYLHYSID*RLFTL 1 LRI FADFPYLH SI+ RL TL Sbjct: 1 LRIYFADFPYLHVSINQRLLTL 22 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 LRIQFADFPYLHYSID*RLFTL 1 LRI FADFPYLH SI+ RL TL Sbjct: 1 LRIYFADFPYLHCSINQRLLTL 22 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 LRIQFADFPYLHYSID*RLFTL 1 LRI FADFPYLH SI+ RL TL Sbjct: 1 LRIYFADFPYLHCSINQRLLTL 22 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 LRIQFADFPYLHYSID*RLFTL 1 LRI FADFPYLH SI+ RL TL Sbjct: 2 LRIYFADFPYLHCSINQRLLTL 23 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 LRIQFADFPYLHYSID*RLFTL 1 LRI FADFPYLH SI+ RL TL Sbjct: 1 LRIYFADFPYLHCSINQRLLTL 22 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 97 PVLRANPYSEVTDPICRLPL 38 P LRANP+ EVTD CRLPL Sbjct: 37 PTLRANPFPEVTDLFCRLPL 56 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 97 PVLRANPYSEVTDPICRLP 41 P LRANP+ EVTD CRLP Sbjct: 141 PTLRANPFPEVTDLFCRLP 159 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 60 IQFADFPYLHYSID*RLFTL 1 I FADFPYLH SI+ RL TL Sbjct: 4 IYFADFPYLHVSINQRLLTL 23 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 60 IQFADFPYLHYSID*RLFTL 1 I FADFPYLH SI+ RL TL Sbjct: 10 IYFADFPYLHCSINQRLLTL 29 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 72 PKLRIQFADFPYLHYSID*RLFTL 1 P++ FADFPYLH SI+ RL TL Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTL 68 >SB_58281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/63 (23%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 376 QNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASGVN-GGSNYDSLKVAK 552 +N++G+ + CL + D +GC R+++ + R + + +N G +NYD++ + + Sbjct: 530 ENYNGEDGAPCLFPSNWIDASQGCYRSLVFHAFASSLRHFLARALMNEGHTNYDAMTLVQ 589 Query: 553 CLV 561 +V Sbjct: 590 EIV 592 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 31.5 bits (68), Expect = 0.69 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 157 TNIDQTRHRPHPLPVQTRHAPVLRA--NPYSEVTDP 56 T+ QT+HRPH P QT H P P+ TDP Sbjct: 167 TDPTQTQHRPHTDPTQTPHGPHTDPTWTPHRPNTDP 202 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -1 Query: 166 T*RTNID--QTRHRPHPLPVQTRHAPVL--RANPYSEVTDP 56 T RT+ D QT+HRP+ P QT+H P P+ TDP Sbjct: 151 TTRTHTDPTQTQHRPNTDPTQTQHRPHTDPTQTPHGPHTDP 191 >SB_10665| Best HMM Match : PT (HMM E-Value=6.2) Length = 215 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 157 TNIDQTRHRPHPLPVQTRHAP--VLRANPYSEVTDP 56 T+ +TRH PH P +TRH P P+ TDP Sbjct: 23 TDPTRTRHGPHTDPTRTRHGPHTDTTRTPHGHDTDP 58 Score = 31.1 bits (67), Expect = 0.92 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 157 TNIDQTRHRPHPLPVQTRHAPVLRA--NPYSEVTDP 56 TN QT+H PH P QT H P P+ TDP Sbjct: 111 TNPTQTQHGPHTNPTQTPHGPHTDPTWTPHRPNTDP 146 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 397 ESDCLIKTKHCDGPRGC*RNVISAQCSE 480 E DC+ +KHCDG C C E Sbjct: 73 EGDCIPLSKHCDGTWDCQHGTDEMDCQE 100 >SB_38261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 171 NEHNARTSTRPGTG-RIRFPSKPDTPRSSEPILIPKL 64 N H A R G+ R R PS+ D+P++++P +I ++ Sbjct: 185 NMHEAILGARMGSASRDRHPSESDSPKATKPAVITRI 221 >SB_26554| Best HMM Match : CPSase_L_D3 (HMM E-Value=0) Length = 268 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 546 YLKRVIVTPAVYPACLNFFTLTFRA 472 ++K++ A YPAC N+ LT+ A Sbjct: 142 FIKQIDTVAAEYPACTNYLYLTYNA 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,661,178 Number of Sequences: 59808 Number of extensions: 504311 Number of successful extensions: 1667 Number of sequences better than 10.0: 254 Number of HSP's better than 10.0 without gapping: 1530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1660 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -