BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1400 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 54 1e-07 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 54 2e-07 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 54 2e-07 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 53 2e-07 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 53 3e-07 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 52 4e-07 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 52 4e-07 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 51 9e-07 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 49 4e-06 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 48 1e-05 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 48 1e-05 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 46 3e-05 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 40 0.003 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP+F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPDFQGSSRAHRTPQEVWC 102 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP FS ++ + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFSGASRAHRTPQEVWC 91 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 105 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 154 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/86 (38%), Positives = 44/86 (51%), Gaps = 2/86 (2%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR--SEP 585 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP + S+ + Sbjct: 205 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEALTSATEVAFT 262 Query: 584 YLPSIGFHGTRTLRQKRKLFPDLSAG 507 ++ F ++T R L P G Sbjct: 263 FITPRSFDHSKTRTHVRLLGPCFKTG 288 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ RTP ++ C Sbjct: 92 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRVHRTPQEVWC 141 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 9 FPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 126 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 48 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 97 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 25 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 74 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 8 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 126 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 126 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 60 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 109 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 195 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 244 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 63 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 112 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 8 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 15 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 64 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVCC 102 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 165 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 214 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 126 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 125 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 174 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 9 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 126 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 8 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 74 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 123 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 268 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 317 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 164 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 213 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 60 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 109 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 164 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 213 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 151 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 200 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 52 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 101 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 92 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 141 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLHTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/49 (53%), Positives = 31/49 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 612 FPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP + Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQE 99 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/52 (50%), Positives = 31/52 (59%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYNRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 52.4 bits (120), Expect = 4e-07 Identities = 32/86 (37%), Positives = 43/86 (50%), Gaps = 2/86 (2%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR--SEP 585 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + S+ + Sbjct: 192 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEALTSATEVAFT 249 Query: 584 YLPSIGFHGTRTLRQKRKLFPDLSAG 507 ++ F ++T R L P G Sbjct: 250 FISPRSFDHSKTRTHVRLLGPCFKTG 275 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 52.4 bits (120), Expect = 4e-07 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPY 582 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + + R PY Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE---TGRMRPY 106 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH +I+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 66 FPYLHCAINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 115 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 52.0 bits (119), Expect = 5e-07 Identities = 26/51 (50%), Positives = 31/51 (60%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMR 606 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + R Sbjct: 91 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQENR 139 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 51.6 bits (118), Expect = 7e-07 Identities = 26/51 (50%), Positives = 31/51 (60%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMR 606 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + R Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEDR 90 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 313 DRLTREQLLFTRNPSPRQSS 254 DRLT QLLFT N SP +SS Sbjct: 89 DRLTHVQLLFTWNLSPLRSS 108 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 7e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL TLETCCGY Y+ R P+ F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTRKSMSFPN--FQGPSRAHRTPQEVWC 102 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.2 bits (117), Expect = 9e-07 Identities = 25/52 (48%), Positives = 31/52 (59%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 FPYLH SI+ RL LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 FPYLHCSINQRLLKLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/46 (52%), Positives = 29/46 (63%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 621 FPYLH SI+ RL TLETCCGY Y+ R P+ EF + S R+ Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPNIEFLQPGGSTRS 98 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 51.2 bits (117), Expect = 9e-07 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 630 FPYLH SI+ RL TLETCCGY Y+ R PEFSR ES Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSFPEFSRVVES 93 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 51.2 bits (117), Expect = 9e-07 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQM 609 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 42 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 51.2 bits (117), Expect = 9e-07 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQM 609 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 612 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 99 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 612 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 99 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTP 618 FPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP Sbjct: 53 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTP 97 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 49.2 bits (112), Expect = 4e-06 Identities = 25/54 (46%), Positives = 31/54 (57%) Frame = -1 Query: 755 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR 594 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ R Sbjct: 159 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEICTGGR 210 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = -1 Query: 758 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 630 FPYLH SI+ RL TLETCCGY Y+ R SP F + ES Sbjct: 8 FPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGAVES 48 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 48.0 bits (109), Expect = 8e-06 Identities = 24/51 (47%), Positives = 30/51 (58%) Frame = -1 Query: 755 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 603 P LH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 PLLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-VRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 18 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 69 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 70 --ADLGGSSKYSNES 82 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 18 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 69 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 70 --ADLGGSSKYSNES 82 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 18 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 69 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 70 --ADLGGSSKYSNES 82 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 97 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 148 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 149 --ADLGGSSKYSNES 161 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%) Frame = +1 Query: 28 THLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGREPLGAS 207 THLPKQ ALKMDGA+A LY V DAK V R ++A G+ +S Sbjct: 12 THLPKQLALKMDGAQASHLYRAV--GADAKLR-----RVGGRG-GRDAASGASLGETASS 63 Query: 208 VGADLGGSSKYSSEA 252 ADLGGSSKYS+E+ Sbjct: 64 --ADLGGSSKYSNES 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,822,547 Number of Sequences: 59808 Number of extensions: 571343 Number of successful extensions: 3169 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2415 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -