BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1399 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.0 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 2.7 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 2.7 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.6 At5g45730.1 68418.m05622 DC1 domain-containing protein contains ... 29 3.6 At5g42370.1 68418.m05159 expressed protein 29 3.6 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.6 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 4.7 At5g22390.1 68418.m02612 expressed protein 27 8.2 At4g31805.1 68417.m04519 WRKY family transcription factor identi... 27 8.2 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 8.2 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 415 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 320 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 481 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 305 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 481 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 305 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 202 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 68 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g45730.1 68418.m05622 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 519 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -3 Query: 392 PVQTRHAPVLRANP----YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWYEPA 243 P +RH P+ + +P Y++ CR PL L Y + LR W PA Sbjct: 68 PCHSRH-PLKKVSPETIDYTDGKCQFCRSPLVDLMYHCSICNFSVDLRCWLNPA 120 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 141 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 31 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 4 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 135 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 197 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 99 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 76 ERSGKSFLFCLSVRVPWNPIEG 141 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At4g31805.1 68417.m04519 WRKY family transcription factor identical to WRKY DNA-binding protein 18 (WRKY18) GI:13506730 from [Arabidopsis thaliana] Length = 344 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -3 Query: 257 WYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEP 147 W++ A L PE SRS P CS RS P Sbjct: 293 WWKDAARLLAQRVPESSRSGLEWCNPDSSTCSERSVP 329 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 239 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 150 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,935,415 Number of Sequences: 28952 Number of extensions: 329132 Number of successful extensions: 985 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 985 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -