BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1398 (520 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 28 5.3 SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 146 IYNGHISVSNITEVVVLVFFCVY*QIFSGLYAFY 45 IY GH ++ + V+ L F +F+GL+ Y Sbjct: 78 IYRGHYNIKEVRHVIALFVFVTITWLFAGLHLAY 111 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = +2 Query: 209 RFMQKKLHINLTSYCC-------KSYFWLN*FSIF*NRTKQF 313 RF+ KKL + YCC +Y+W N S F NR ++ Sbjct: 560 RFVIKKLTKMIRKYCCMHCNARIAAYYWSNLSSAFRNRVSEY 601 >SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 194 EHKGNRFMQKKLHINLTSYCCKSYFWLN 277 EH +M+ L ++ YC +S WLN Sbjct: 62 EHNAEHWMEVVLQMDNMEYCSESVCWLN 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,588,248 Number of Sequences: 59808 Number of extensions: 310962 Number of successful extensions: 615 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -