BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1398 (520 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051932-1|AAK93356.1| 562|Drosophila melanogaster LD41462p pro... 28 8.7 AE014298-1854|AAF48234.1| 562|Drosophila melanogaster CG4332-PA... 28 8.7 >AY051932-1|AAK93356.1| 562|Drosophila melanogaster LD41462p protein. Length = 562 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 290 F*NRTKQFKPVRQFNLFVTNCVHPKTISVTSLRLVLLQLHPTRS 421 F R K PV + T H K + V LRL+LL H T++ Sbjct: 219 FNTRLKDLVPVTRNTTEFTFSFHYKPVGVGKLRLMLLMEHATQA 262 >AE014298-1854|AAF48234.1| 562|Drosophila melanogaster CG4332-PA protein. Length = 562 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 290 F*NRTKQFKPVRQFNLFVTNCVHPKTISVTSLRLVLLQLHPTRS 421 F R K PV + T H K + V LRL+LL H T++ Sbjct: 219 FNTRLKDLVPVTRNTTEFTFSFHYKPVGVGKLRLMLLMEHATQA 262 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,939,249 Number of Sequences: 53049 Number of extensions: 431057 Number of successful extensions: 711 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1908489216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -