BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1398 (520 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 2.5 At1g05060.1 68414.m00507 expressed protein 27 7.6 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 155 NLYIYNGHISVSNITEVVVLVFFCVY*QIFSGL 57 NL+I NGH + T++ + VF C+ ++F L Sbjct: 526 NLFITNGHYFLKEKTDLFLSVFSCLVFEMFCSL 558 >At1g05060.1 68414.m00507 expressed protein Length = 253 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +1 Query: 388 SSTATVTPDTFDPVFYHISITNTFFG*EHFVLPKHSA*VLSN 513 ++T +++PD +P+ ++S+ FG + LP+ VL++ Sbjct: 89 NATVSISPDVLNPLRGYVSLPQVTFGRRRWDLPESENSVLAS 130 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,661,180 Number of Sequences: 28952 Number of extensions: 206455 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -