BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1397 (566 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 5.9 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 7.7 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 5.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -2 Query: 187 GYLKRVIVTPAVYPRLLEFLHVDIQST 107 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.0 bits (52), Expect = 7.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 181 LKRVIVTPAVYPRLLEFLHVDIQSTGQKSHC 89 L + IVT + + RLLE+L D S Q S C Sbjct: 1789 LTKRIVTLSDHYRLLEYLLKDESSCSQASQC 1819 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,237,711 Number of Sequences: 5004 Number of extensions: 43703 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -