BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1397 (566 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166... 30 1.5 06_03_0854 + 25400855-25403741,25406174-25407708 29 2.6 04_04_0940 - 29539138-29539626,29540125-29540531,29540631-295406... 28 6.0 03_06_0670 + 35434203-35434355,35436601-35436729,35436978-354384... 28 6.0 03_02_0798 - 11321590-11321685,11321802-11321888,11321972-113220... 28 6.0 01_05_0635 - 23847255-23847287,23847397-23848083,23848178-238485... 28 6.0 >02_05_0110 + 25914110-25915006,25915726-25915797,25916411-25916699, 25916864-25916949,25917267-25917490,25917674-25917740, 25917830-25917889,25917995-25918078,25918475-25918555 Length = 619 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 205 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTG 104 LDDE YL R V + RLL+F++VD STG Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTG 313 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 387 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 262 AKR+PT T P AR +++ +F +P P P +V+S Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515 >04_04_0940 - 29539138-29539626,29540125-29540531,29540631-29540662, 29540809-29541086,29541164-29542515,29542616-29542874 Length = 938 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 369 YATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDIDRDSGNL 232 Y P + + S G +FP DSP V L+ L++ ++G+L Sbjct: 757 YQNPKFAVVGSEFTKSGWGFAFPRDSPLSVDLSTAILELS-ENGDL 801 >03_06_0670 + 35434203-35434355,35436601-35436729,35436978-35438409, 35438524-35439014 Length = 734 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 209 VTRMNGLTRFPLSLSISSETTAKGTGLGESAGKE 310 + R NGL R P S+SISS+ G G + GKE Sbjct: 396 IRRPNGLVRPPESISISSKKPDAG-GASPAMGKE 428 >03_02_0798 - 11321590-11321685,11321802-11321888,11321972-11322082, 11322169-11322515,11322570-11322612,11322669-11322749, 11323321-11323596,11325277-11325552 Length = 438 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -3 Query: 294 SPKPVPLAVVSLDIDRDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACL 136 SP+ + AV S DID D G+L+ + +T ++ +S P ACL Sbjct: 72 SPEDLDSAVESTDIDTDIGSLIKGTVFMTTSNGAYVDIQSKSTAFLPLDEACL 124 >01_05_0635 - 23847255-23847287,23847397-23848083,23848178-23848540, 23848633-23848725,23848820-23848870,23849031-23849304, 23849766-23850595 Length = 776 Score = 27.9 bits (59), Expect = 6.0 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -2 Query: 532 GDERFGHVPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRS----RETISH 371 G +R VP L ++ AP + +RAP PP ++ VVVF R++ +E +SH Sbjct: 99 GRKRHDAVPAAVL-RENMAPPE--ERAPPPPPAPPPKSSHVVVFSRQADPTEKENVSH 153 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,567,407 Number of Sequences: 37544 Number of extensions: 325541 Number of successful extensions: 1054 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -