BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1397 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 59 2e-09 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 1e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) 29 3.5 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 6.1 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 28 6.1 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 28 6.1 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 6.1 SB_53612| Best HMM Match : SRCR (HMM E-Value=0) 28 6.1 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 28 6.1 SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) 28 6.1 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 6.1 SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 28 6.1 SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) 28 6.1 SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) 28 6.1 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 378 SPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 256 +PTY+TPLMS + RLESSSTGSSFPAD KPVPLAVVSLD Sbjct: 88 TPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAVVSLD 128 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -2 Query: 448 LPPNRVSNETMKVVVFQRR 392 LP +R+S +T++VVVF RR Sbjct: 67 LPLHRISKKTIRVVVFHRR 85 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 59.3 bits (137), Expect = 2e-09 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 119 HSEHWAEITLRQHPRGPSQXFVLIRQSDSPCPCQF 15 ++EHWAEITLRQH PSQ FVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 190 MPRHLISDAHEWINEIPTVPI 252 MPRHLISDAHEWINEIPTVPI Sbjct: 1 MPRHLISDAHEWINEIPTVPI 21 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 107 SALNVNVKKFKQARVNGGSNYDSL 178 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 110 ALNVNVKKFKQARVNGGSNYDSL 178 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 104 PSALNVNVKKFKQARVNGGSNYDS 175 PSALNV VKKF QARVNGG +S Sbjct: 31 PSALNVKVKKFNQARVNGGDPLES 54 >SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -3 Query: 381 RSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDID 250 R PT P + Y +S TG +F AD P+ VP+ VS I+ Sbjct: 117 RRPTDDPPPLPDYVMVRFTSYTGPAFIADDPQVVPIVPVSRSIE 160 >SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) Length = 801 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 563 PRTGSRGSF-KRRRAFRPRPTLHAWNETPCARRYYRPRTASAQPS 432 P+ GS+ S KRRR P + ET C+RR + A+P+ Sbjct: 65 PKLGSKLSVGKRRRQAESPPRTQTFAETLCSRRAFHVHKKLAKPN 109 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 374 VFGRDFDIITDHKPLLSLFH 393 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 493 GTKHRAPADIIDRAPLPPNRV 431 GT HR PA+ R +P NRV Sbjct: 519 GTHHRVPAEATGRVDVPDNRV 539 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -2 Query: 475 PADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 377 PA + +++PLP N ++E +++ QRR E + Sbjct: 2409 PAKLPNQSPLPNNASASEIQRILENQRREEELL 2441 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 1317 VFGRDFDIITDHKPLLSLFH 1336 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 79 VFGRDFDIITDHKPLLSLFH 98 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_53612| Best HMM Match : SRCR (HMM E-Value=0) Length = 409 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 387 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 277 A + T ATP SP R +++ SS SP P P Sbjct: 366 ASSASTPATPDSSPKRKRTRQANSASSSQPSSPHPAP 402 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 493 GTKHRAPADIIDRAPLPPNRV 431 GT HR PA+ R +P NRV Sbjct: 225 GTHHRVPAEATGRVDVPDNRV 245 >SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) Length = 300 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 259 VFGRDFDIITDHKPLLSLFH 278 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 568 VFGRDFDIITDHKPLLSLFH 587 >SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 429 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 347 VFGRDFDIITDHKPLLSLFH 366 >SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 773 VFGRDFDIITDHKPLLSLFH 792 >SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) Length = 309 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) Length = 391 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 367 ISGRSFRAIVAEKPLLSLFH 426 + GR F I KPLLSLFH Sbjct: 241 VFGRDFDIITDHKPLLSLFH 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,595,556 Number of Sequences: 59808 Number of extensions: 358619 Number of successful extensions: 859 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -