BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1397 (566 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.0 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 6.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 9.2 AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 23 9.2 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 23 9.2 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.0 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 199 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 89 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.0 bits (47), Expect = 6.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 377 DRFARSSLKNHYFHCFITYSVGRKRC 454 DRFA ++ + H F+ + G + C Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 9.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 392 SSLKNHYFHCFITYSVGRK 448 SS +FHC+ GRK Sbjct: 403 SSFFQQFFHCYCPVKFGRK 421 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 22.6 bits (46), Expect = 9.2 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 294 SPKPVPLAVVSLDID 250 SP+P P+ V++ D+D Sbjct: 190 SPRPAPVLVLNADLD 204 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 22.6 bits (46), Expect = 9.2 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 294 SPKPVPLAVVSLDID 250 SP+P P+ V++ D+D Sbjct: 191 SPRPAPVLVLNADLD 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,874 Number of Sequences: 2352 Number of extensions: 10940 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -