BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1397 (566 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase... 30 6.5 AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. 30 6.5 >BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase protein. Length = 1042 Score = 29.9 bits (64), Expect = 6.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 19 WHGQGESDCLIKTKXCDGPRGC*RNVISAQCSECQREEIQAS 144 W CL T CDG C + CS CQ +E++ + Sbjct: 622 WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECA 663 >AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. Length = 1042 Score = 29.9 bits (64), Expect = 6.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 19 WHGQGESDCLIKTKXCDGPRGC*RNVISAQCSECQREEIQAS 144 W CL T CDG C + CS CQ +E++ + Sbjct: 622 WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECA 663 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,750,190 Number of Sequences: 237096 Number of extensions: 1688483 Number of successful extensions: 3785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3782 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5759818212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -